KEGG   Helicobacter pylori Sat464: HPSAT_02350Help
Entry
HPSAT_02350       CDS       T01897                                 

Definition
(GenBank) iron-regulated outer membrane protein
  KO
K02014  iron complex outermembrane recepter protein
Organism
hpt  Helicobacter pylori Sat464
Brite
KEGG Orthology (KO) [BR:hpt00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hpt02000]
    HPSAT_02350
Transporters [BR:hpt02000]
 Other Transporters
  Pores ion channels [TC:1]
   HPSAT_02350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TonB_dep_Rec Plug
Motif
Other DBs
NCBI-ProteinID: ADO05217
Position
complement(464746..467121)
Genome map
AA seq 791 aa AA seqDB search
MFLRSYSKLRYALCFPLLADTCYSEERTLNKVTTQAKRIFTYNNEFKVTSKELDQRQSNE
VKDLFRTNPDVNVGGGSVMGQKIYVRGIEDRLLRVTVDGAAQNGNIYHHQGNTVIDPGML
KSVEVTKGSANASAGPGAIAGVIKMETKGAADFIPRGKNYAASGAVSFYTNFGDRETFRS
AYQSAHFDIIAYYTHQNIFYYRSGATAMKNLFKPTQADKEPGTPSEQNNALVKMNGYLSD
RDTLTFSWNMTRDNATRPLRSNAIGLAYPCEAPFSPDSDQGCPNVLDSFTRYMYHSINSA
NNLSLQYKREAGNSFGDPRLDFTLYTSIRNAKFDPLFDPNGVYAKFPTSQASAWEKENYP
CVEGGYCTPSFSDVDKPSSQPRDLFLNNTGLNLKVAHVIDEATDSLFEYGFNYQNLSVFD
ARIPKSELYRPNQVYTDDKGQKQIACSLVDNNPNDPTLCQRGKANGNIYGGYVQANYSPH
KIITFGAGVRWDAYTLYDKDWNHRYTQGFSPSAALVISPIEPLSLKITYSQVTRGVMPGD
GVYMRQNDLRYAKNIKPEVGSNAEFNIDYSSQYFSGRAAAFYQALDNFISQYAQSLIVTN
LSQAIRIYGYEVGGTFKYKGVSLNVGISRTWPTTRGYLMADSYELAASTGNVFIIKLDYT
IPKTGINLAWLSRFVTGLDYCGFDIYLPDYGTAEKPKTPTDLAKCGSQLGLVHMHKPGYG
VSNFYINWSPKTKSRWKGLLLSAVFNNVFNKFYVDQTSPYVMSPDMPGTDAIKRAIAEPG
FNARFEVAYKW
NT seq 2376 nt NT seq  +upstreamnt  +downstreamnt
atgtttttaagatcatactcaaagcttagatacgctttatgtttccccctactcgctgat
acttgctatagcgaagagcgcactttaaataaggttaccacccaagctaaaaggattttc
acttacaacaatgagtttaaagtaacttctaaagaattagatcaacgccaaagcaatgaa
gtcaaggacttgtttaggactaaccctgatgtgaatgtgggcggagggagcgtgatgggg
cagaaaatctatgtgagaggcattgaagacaggcttttaagggttacggtggatggggct
gcgcaaaatggcaatatctaccaccaccaaggcaacaccgtgattgaccctggcatgctc
aaaagcgtggaagttaccaaaggatcagcgaatgcgagtgcagggccaggagcgatcgca
ggagtgattaaaatggagactaaaggagcggctgattttatccctagggggaaaaattat
gccgccagtggggcggtgagtttttataccaattttggcgatcgagaaactttcagatcg
gcttatcaaagtgcgcattttgatattatcgcttactacacgcaccaaaacatcttctat
tatagaagcggtgctacagcgatgaaaaaccttttcaaacccacacaagccgataaagag
ccaggaactcctagcgagcaaaacaacgctttagttaaaatgaatggttatttgagcgat
agagacacgctcactttcagctggaacatgacacgagataacgctacacgccctttaagg
agtaacgctatagggttagcctatccttgtgaagccccttttagtcctgatagcgatcaa
gggtgtcctaatgtgttggatagtttcacaagatacatgtatcactccatcaatagtgcc
aacaatctttccttacaatacaaaagggaagcgggaaattcttttggcgacccacgatta
gattttaccctttatacaagcattagaaacgccaagtttgatcccctatttgatcctaat
ggcgtttatgctaaattccccacttctcaagcgagcgcatgggaaaaagaaaattaccca
tgcgttgaaggcgggtattgcaccccaagcttttcagatgtggataaaccaagctcacag
cctagggatttgtttttaaacaacaccgggttaaaccttaaagtcgcgcatgtgattgat
gaagccacagacagcctttttgaatacggattcaactaccaaaatttaagcgtttttgac
gctcgcatccctaaatcagaattatacaggcctaatcaagtttatactgatgataaaggg
caaaaacaaatcgcttgctctcttgtggataataaccccaatgaccctactttatgccaa
agagggaaagcgaacgggaatatttatggaggctatgtgcaagcgaattactcacctcat
aaaatcatcacttttggagccggggtaaggtgggacgcatacacgctttatgataaagac
tggaaccaccgctacactcaaggctttagccctagcgcggctcttgtgatcagccccatt
gagcctctatcgttaaaaatcacttattctcaagttacaaggggggttatgccaggagat
ggcgtgtatatgcgccaaaacgatttacgatacgctaaaaatatcaagcctgaagtgggc
tctaacgctgaatttaatattgattattcaagccagtattttagcgggagggctgcggcg
ttttatcaggctctggataatttcatctcacaatacgcgcaaagtttgattgtaaccaat
ttgagtcaagcgattaggatttatggctatgaagtgggtgggactttcaaatacaagggc
gtgagtttgaatgtggggatctcgcgcacttggcccaccactagggggtatttaatggca
gacagctatgagcttgccgcaagcaccggtaatgtttttatcattaaattggattacacc
atccccaaaacagggatcaatcttgcttggcttagccgctttgttaccggtttagattat
tgcgggtttgatatttacttgcctgattacgggacggctgaaaaacccaaaacccctacc
gatttagccaaatgcggatcccaattagggttagtgcatatgcataaaccgggctatggc
gtgagtaatttttatatcaattggagtcctaaaaccaaaagccgctggaaaggtttgttg
ctttcagccgtgtttaataatgttttcaacaaattctatgtggatcaaacaagcccttat
gtcatgagtccggacatgccaggcaccgacgctattaaaagagcgatcgcagagcccggg
tttaacgcacgctttgaagtggcttacaaatggtga

DBGET integrated database retrieval system