KEGG   Helicobacter pylori Sat464: HPSAT_02380Help
Entry
HPSAT_02380       CDS       T01897                                 

Gene name
flgE
Definition
(GenBank) flagellar hook protein FlgE
  KO
K02390  flagellar hook protein FlgE
Organism
hpt  Helicobacter pylori Sat464
Pathway
hpt02040  Flagellar assembly
Brite
KEGG Orthology (KO) [BR:hpt00001]
 09140 Cellular Processes
  09142 Cell motility
   02040 Flagellar assembly
    HPSAT_02380 (flgE)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:hpt02035]
    HPSAT_02380 (flgE)
Bacterial motility proteins [BR:hpt02035]
 Flagellar system
  Flagellar assembly proteins
   Rod,hook and filament
    HPSAT_02380 (flgE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Flg_bbr_C FlaE Flg_bb_rod Flagellin_IN
Motif
Other DBs
NCBI-ProteinID: ADO05223
Position
471978..474134
Genome map
AA seq 718 aa AA seqDB search
MLRSLWSGVNGMQAHQIALDIESNNIANVNTTGFKYSRASFVDMLSQVKLIATAPYKNGL
AGQNDFSVGLGVGVDATTKIFSQGNIQNTDVKTDLAIQGDGFFIISPDRGITRNFTRDGE
FLFDSQGSLVTTGGLVVQGWVRNGSDTGNKGSDTDALKVDNTGPLENIRIDPGMVMPARA
SNRISMRANLNAGRHADQTAAIFALDSSAKTPSDGINPVYDSSTNLTQVAEDMGSLYNED
GDALLLNENQGIWVSYKSAKMVKDILPSAENSTLELNGVKISFTNDSAVSRTSSLVAAKN
AINAVKSQTGIEAYLDGKQLRLENTNELDGDEKLKNIVVTQAGTGAFANFLDGDKDVTAF
KYSYTHSISPNADIGQFRTTEDLRALIQHDANIVKDPSLADNYQDSAASIGVSVNQYGMF
EINNKDNKNVIKENLNIFVSGYSSDSVTNNVLFKNAMKGLNTASLIEGGASASSSKFTHA
THATSIDVIDSLGTKHAMRIEFYRSGGAEWNFRVIVPEPGELVGGSAARPNVFEGGRLHF
NNDGSLAGMNPPLLQFDPKNGADAPQRINLAFGSSGSFDGLTSVDKISETYAIEQNGYQA
GDLMDVRFDSDGVLLGAFSNGRTLALAQVALANFANDAGLQALGGNVFSQTGNSGQALIG
AANTGRRGSISGSKLESSNVDLSRSLTNLIVVQRGFQANSKAVTTSDQILNTLLNLKQ
NT seq 2157 nt NT seq  +upstreamnt  +downstreamnt
atgcttaggtctttatggtctggtgtcaatgggatgcaagcccaccaaatcgctttggat
attgagagtaataatattgcgaatgtgaataccactggttttaaatattctagggcttct
tttgtggatatgctctctcaagtcaaactcatcgctaccgcgccctataaaaacgggtta
gcagggcagaatgacttttctgtggggcttggggtaggcgtggatgcgacaactaaaatc
ttttcacaaggcaatatccaaaacacagatgtcaaaaccgatctagcgattcaaggcgat
ggcttttttatcattagccctgatagggggatcacgcgcaatttcaccagagatggggag
ttcctttttgactcgcaagggagtttggttaccaccggtgggcttgtggtgcaagggtgg
gtgcgaaacgggagcgataccggcaataaagggagcgatacggacgctttaaaagtggat
aacacaggccctttagaaaacattagaattgatcctggaatggtgatgccagccagagcg
agtaaccgcatttctatgagagcgaatttaaacgctggaaggcatgccgatcaaacagcg
gcgatatttgctttggattcttcagccaaaaccccttcagatggcattaatccggtgtat
gattcaagcacgaatctaactcaagtcgccgaagacatgggatctttatacaatgaagat
ggcgacgctcttttattgaatgaaaatcaagggatttgggtgagttataagagcgcaaaa
atggtcaaagacatcctcccttctgcagaaaacagcacgcttgaattgaatggggttaag
atttctttcacgaacgattcagcggttagcaggacttcaagcctagtggcagccaaaaat
gcgatcaatgcggtcaaaagccaaacaggcattgaagcctatttggacggcaagcaattg
cgtttggaaaacaccaatgaattagacggcgatgaaaagcttaaaaacattgtggtcact
caagccggaaccggggcgttcgctaattttttagacggcgataaagatgtaacggctttc
aaatacagctacacgcattctatcagccctaatgcggatattgggcagtttaggaccact
gaagacttgcgcgcattaatccagcatgacgctaatatcgttaaagatcctagcttggcg
gacaattaccaggactcagcggcttctataggggttagcgtcaatcaatacggcatgttt
gaaatcaataacaaagacaataaaaatgtcattaaagaaaatctcaatatctttgtgagc
gggtattcttcagacagcgtaacgaacaatgttttgtttaaaaacgcgatgaaagggctt
aataccgcttctttaattgaagggggagcgtcagcgagcagttctaaattcacccacgca
acccatgcgacaagcattgatgtgatagacagcttaggcactaaacacgccatgcgcatt
gaattttataggagtgggggagcggaatggaatttcagggtgatcgtgcctgagcctggg
gaattagtaggggggtcagcggctaggcctaatgtgtttgaaggaggccgtttgcacttc
aataacgacggatcgcttgcaggcatgaacccgcctcttttgcaatttgaccctaaaaat
ggtgctgatgccccccaacgcatcaatttagcctttggttcttcagggagctttgatggg
ctaacgagcgtggataagatttctgaaacttatgcgattgaacaaaatggctatcaagcg
ggcgatttgatggatgtccgctttgattcagacggggtgcttttaggggcgttcagtaat
ggcaggactttggcgctcgcgcaagtggctttagcgaatttcgctaacgatgcgggctta
caggctttaggcgggaatgtcttttctcaaaccggaaattcaggacaagccttaatcggt
gcggctaatacggggcgtaggggttcgatttcaggatctaaattggagtctagtaatgtg
gatttgagccggagtttaacgaatttgattgtggttcaaagggggtttcaagcgaactct
aaagcggtaaccacatccgatcaaatccttaacaccctattgaatcttaagcaataa

DBGET integrated database retrieval system