KEGG   Helicobacter pylori Sat464: HPSAT_02385Help
Entry
HPSAT_02385       CDS       T01897                                 

Gene name
hypA
Definition
(GenBank) hydrogenase nickel incorporation protein
  KO
K04651  hydrogenase nickel incorporation protein HypA/HybF
Organism
hpt  Helicobacter pylori Sat464
Brite
KEGG Orthology (KO) [BR:hpt00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:hpt03110]
    HPSAT_02385 (hypA)
Chaperones and folding catalysts [BR:hpt03110]
 Other chaperones and cochaperones
  Others
   HPSAT_02385 (hypA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HypA zinc_ribbon_4 Zn-ribbon_8 SBP
Motif
Other DBs
NCBI-ProteinID: ADO05224
Structure
PDB: 

Position
474192..474545
Genome map
AA seq 117 aa AA seqDB search
MHEYSVVSSLIALCEEHAKKNQAHKIERVVVGIGERSAMDKSLFVSAFETFREESLVCKD
AILDIVDEKVELECKDCSHVFKPNALDYGVCEKCHSKNVVITQGNEMRLLSLEMLAE
NT seq 354 nt NT seq  +upstreamnt  +downstreamnt
atgcatgaatactcggtcgtttcttctttaatcgctctttgcgaagagcatgcgaagaaa
aatcaagcccataagattgaaagagttgtggtcggtattggcgaaagaagcgctatggat
aagagcttgtttgtgagcgcgtttgagacttttagagaagaatctttagtgtgtaaggac
gctattttagacattgtggatgaaaaagttgaattagaatgcaaggattgttcgcatgtt
tttaagcctaacgcactagattatggggtgtgtgagaaatgccacagcaagaatgtcgtt
atcactcaaggcaatgaaatgcgtttgttgtctttggaaatgttagcggaataa

DBGET integrated database retrieval system