KEGG   Helicobacter pylori Sat464: HPSAT_02420Help
Entry
HPSAT_02420       CDS       T01897                                 

Definition
(GenBank) pantothenate kinase
  KO
K03525  type III pantothenate kinase [EC:2.7.1.33]
Organism
hpt  Helicobacter pylori Sat464
Pathway
hpt00770  Pantothenate and CoA biosynthesis
hpt01100  Metabolic pathways
Module
hpt_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:hpt00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    HPSAT_02420
Enzymes [BR:hpt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.33  pantothenate kinase
     HPSAT_02420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pan_kinase DUF2654
Motif
Other DBs
NCBI-ProteinID: ADO05231
Position
479432..480103
Genome map
AA seq 223 aa AA seqDB search
MPARQSFTDLENLVLCDIGNTRIHFVQNYQLFSSAKEDLKRLGIQKEIFYISVNEENEKV
LLNCYPNAKNIAGFFHLETDYIGLGIDRQMACLAVNNGVIVDAGSAITIDLVKESKHLGG
CILPGLAQYIHAYKKSAKILEQPFKALDSLEVLPKNTRDAVNYGMILSVISCIQHLAKNQ
KIYLCGGDAKYLSAFLPHSVCKERLVFDGMEIALKKAGVLECK
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgccagctaggcaatcttttacagatttggaaaacctggttttatgcgatataggcaac
acgcgcatccatttcgtgcaaaattatcagctcttttcaagcgctaaagaagatttaaag
cgtttgggtattcaaaaggaaattttttacattagcgtgaatgaagaaaatgaaaaagtc
cttttgaattgttaccctaacgctaaaaatattgcaggattttttcatttagaaaccgac
tatatagggcttgggatagaccggcaaatggcgtgtctagcggtaaataatggcgtgatc
gtggatgcggggagtgcgattacgattgatttagtcaaagagagcaagcatttaggaggg
tgtattttacccggtttagcccaatatatccatgcgtataaaaaaagcgctaaaatctta
gagcaacctttcaaagccttagattctttagaagttttacctaaaaacactagggacgcc
gtgaattacggcatgattttaagcgtcatctcttgcatccagcatttagccaaaaatcaa
aaaatctatctttgtgggggcgatgcaaagtatttgagcgcgtttttaccccattctgtt
tgcaaggagcgtttggtttttgacgggatggaaatcgctcttaaaaaagcaggggtatta
gaatgcaaatga

DBGET integrated database retrieval system