KEGG   Helicobacter pylori Sat464: HPSAT_02425Help
Entry
HPSAT_02425       CDS       T01897                                 

Definition
(GenBank) hypothetical protein
  KO
K09792  uncharacterized protein
Organism
hpt  Helicobacter pylori Sat464
Brite
KEGG Orthology (KO) [BR:hpt00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    HPSAT_02425
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DsbD_2
Motif
Other DBs
NCBI-ProteinID: ADO05232
Position
480094..480831
Genome map
AA seq 245 aa AA seqDB search
MQMMHNLSFLGMFLAALSMSLGHCVGMCGGIVSAFSQIRFSKVTSFSYQLACHALYNVGR
ISAYMFLGAIAAGLGHSLSVSMGFRGVLFISMGIVLICLALLGAKVEKLSFQIPFISFLM
KKTLQSQNILGLYFLGVLNGFLPCMMVYSFLASVILSHSAFMGAMLGLSFGLGTSVPLFL
MGVFLSKISVSYRKFFNLLSKGLMGVFGLYILYMGIMLINHQNPHAMHHSSETTQHDHKG
MHERH
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgcaaatgatgcacaatttgagttttttgggcatgtttttagccgctttgagcatgtct
ttagggcattgtgtgggcatgtgtggggggattgtgagcgcgtttagtcaaataagattt
tctaaagttacaagcttttcttaccagctcgcttgccatgccctttataatgtaggaagg
atcagcgcttacatgtttttaggggctatagcagcgggtttaggccatagccttagcgtg
agcatgggttttaggggtgttttattcatcagtatggggattgttttgatctgtttagcg
ctcttgggggctaaagtggaaaaattaagctttcaaatccctttcatctctttcttgatg
aaaaaaaccttgcaatctcaaaacattctagggctgtattttttgggcgtgttgaacggg
tttttaccttgcatgatggtgtattcgtttttagcgagcgtgattcttagtcatagcgcg
tttatgggagcgatgctaggcctttcttttgggcttggcaccagcgtgccgttgttttta
atgggggtttttttaagcaaaatttccgtttcttacaggaaatttttcaatcttttgtct
aaaggtttaatgggggtttttgggctttatattctttatatggggatcatgctcattaac
caccaaaacccccatgcgatgcatcattcaagcgaaaccacccaacacgatcacaaggga
atgcatgagcgccactaa

DBGET integrated database retrieval system