KEGG   Helicobacter pylori Sat464: HPSAT_02440Help
Entry
HPSAT_02440       CDS       T01897                                 

Definition
(GenBank) ADP-heptose synthase
  KO
K03272  D-beta-D-heptose 7-phosphate kinase / D-beta-D-heptose 1-phosphate adenosyltransferase [EC:2.7.1.167 2.7.7.70]
Organism
hpt  Helicobacter pylori Sat464
Pathway
hpt00540  Lipopolysaccharide biosynthesis
hpt01100  Metabolic pathways
Module
hpt_M00064  ADP-L-glycero-D-manno-heptose biosynthesis
Brite
KEGG Orthology (KO) [BR:hpt00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    HPSAT_02440
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:hpt01005]
    HPSAT_02440
Enzymes [BR:hpt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.167  D-glycero-beta-D-manno-heptose-7-phosphate kinase
     HPSAT_02440
   2.7.7  Nucleotidyltransferases
    2.7.7.70  D-glycero-beta-D-manno-heptose 1-phosphate adenylyltransferase
     HPSAT_02440
Lipopolysaccharide biosynthesis proteins [BR:hpt01005]
 Unusual sugar
  HPSAT_02440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB CTP_transf_like Phos_pyr_kin FAD_syn
Motif
Other DBs
NCBI-ProteinID: ADO05235
Position
482340..483731
Genome map
AA seq 463 aa AA seqDB search
MKQILVVGDLIADYYLWGRSERLSPEAPVPVLEVQRESKNLGGAANVANNLISLKAKVFL
CGVVGDDLEGEHFINALKARNIDTSCILTDKTRCTTLKTRIIAQNQQIVRVDKEIKDPLN
ADLRKKLLDFFTEKIQEIDGVILSDYNKGVLDFELTQKMIALANKHHKLILCDPKGKDYS
KYAHASLITPNRIELEQALHLKLDSHANLSKALQILKKTYHIAMPLVTLSEQGIAFLEKG
ELVNCPTIAKEVYDVTGAGDTVIASLTLSLLESMSLKEACEFANAAAAVVVGKMGSALAS
LEEIALILNQTHPKILPLEKLLETLEHHQQKIVFTNGCFDILHKGHASYLQKAKALGDIL
IVGLNSDASVKRLKGDKRPIVSEKDRAFLLASLSCVDYVVVFEEDTPIKLIQALKPDILV
KGADYLNKEVIGSEFAKETRLMEFEEGYSTSAIIEKIKRTCND
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaaatcttagtcgtgggggatctgatcgctgattattacctgtgggggagaagc
gaacgcctttcgcctgaagcccctgtgcctgttttagaagtccaaagggagagcaagaat
ttaggcggagcggctaatgtggcgaacaacctcatctctttaaaggctaaagttttttta
tgtggggtcgtgggcgatgatttagagggcgagcattttattaacgctctcaaagccagg
aatattgacacttcatgcattttaacagataaaacccgttgcaccacgctcaaaacgcgc
atcatcgcgcaaaaccagcaaatcgtgcgcgtggataaggaaatcaaagaccccttaaac
gctgatttaagaaaaaaacttttagattttttcacagaaaaaatccaagaaatagatggc
gttatcctttcagattacaataagggcgtgttggattttgaactcactcaaaaaatgatc
gctctagccaacaaacaccacaagctcattttatgcgaccctaaagggaaggattatagc
aaatatgctcatgcgagtttgatcacgcctaatcgcattgaattagaacaagcgctccat
ttgaagttagacagccatgcaaatttatcaaaagcgctccaaatcttaaaaaaaacttat
catatcgccatgcctttagtaactttgagcgaacaaggcatcgcttttttagaaaaaggc
gagttagtcaattgccccactatcgctaaagaagtttatgatgtaaccggtgcaggcgat
acggtgatagcgtctttaacgctctctttattagaatcgatgagcctaaaagaagcttgc
gagtttgccaatgcggctgcggctgtggtggtgggtaaaatggggagcgcgttagcgagt
ttagaagaaatcgctttgattttaaaccaaacgcaccctaaaatcctccctttagaaaag
ctgttagaaactttagagcaccatcagcaaaaaatcgttttcaccaatggctgttttgac
attctccataaagggcatgcgagttatttgcaaaaggctaaagctttaggggatattctc
attgtagggttaaatagcgacgcttccgttaaaaggcttaagggggataaacgccccata
gtgagcgaaaaagacagagcgtttcttttagcgagtttgtcttgcgtggattatgttgtg
gtgtttgaagaagacacgccaatcaaattaattcaagccctaaagcctgatattttagtc
aagggagcggactatctcaataaagaagtcatagggagcgagtttgctaaagaaacccgt
ttgatggaatttgaagaaggttattccacaagcgctatcatagaaaaaattaaaaggaca
tgcaatgattga

DBGET integrated database retrieval system