KEGG   Helicobacter pylori Sat464: HPSAT_02485Help
Entry
HPSAT_02485       CDS       T01897                                 

Definition
(GenBank) anti-codon nuclease masking agent (prrB)
  KO
K01154  type I restriction enzyme, S subunit [EC:3.1.21.3]
Organism
hpt  Helicobacter pylori Sat464
Brite
KEGG Orthology (KO) [BR:hpt00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic Defense System [BR:hpt02048]
    HPSAT_02485
Enzymes [BR:hpt01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.3  type I site-specific deoxyribonuclease
     HPSAT_02485
Prokaryotic defense system [BR:hpt02048]
 Restriction and modification system (R-M system)
  Type I R-M system
   HPSAT_02485
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methylase_S Occludin_ELL
Motif
Other DBs
NCBI-ProteinID: ADO05244
Position
492810..494078
Genome map
AA seq 422 aa AA seqDB search
MHKIERLLQTLAPKGVEFKTLEEVFEIKNGYTPSKNNPEFWEKGTIPWFRMEDIRENGRI
LKDSIQHITPKALKGKKLFPKNSIIISTTATIGEHALLIVDSLANQQFTFLSKKANCDIA
LDMKFFFYQCFLLGEWCKKNTNVSGFASMDMTAFKKYKFPIPPLEIQQEIVKILDAFTEL
NTELNTELKARKKQYQYYQNMLLDFKDIHSNHKDAKIKTYPKRLKTLLQTLAPKGVEFRK
LGEVCESTNKKTLKISEVSEVKNKGMYPVINSGRDLYGYYHDFNNDGENITIASRGEYAG
FINYFNEKIFAGGLCYPYKVKDTNELLTKFLYFYLKTNEIQIMENLVSRGSIPALNKADI
ETLTIPIPPLEIQQEIVKILDQFLALTTDLLAGIPAEIEARKKQYEYYREKLLTFKPLQN
KA
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgcataaaatagagcgcttactccaaaccttagcgcctaagggggtggagtttaaaacg
cttgaagaggtttttgaaattaaaaatggttacaccccatcaaaaaacaatcctgaattt
tgggaaaaagggactatcccttggtttagaatggaagacattagagaaaatgggaggatt
ttaaaagactctatccaacacattaccccaaaggctttaaagggtaagaaattattccct
aaaaattctattattatttctacaacggcaactataggagagcatgcccttttaatcgtt
gattcgttagcgaatcaacaattcacttttttaagcaaaaaagcgaattgtgatattgct
ttagacatgaaattctttttttatcaatgttttcttttaggggaatggtgcaaaaaaaac
actaatgtttcaggttttgcttctatggatatgactgcttttaaaaaatataagttcccc
atcccacccctagaaatccaacaagagatcgttaagattttggacgctttcacagaatta
aacacagaattaaacacagaattaaaagcgcgaaaaaagcaataccagtattaccaaaac
atgcttttagactttaaggacatccattcaaaccataaagacgcaaaaattaaaacctac
cctaaacgcttaaaaaccttactccaaaccttagcgcctaagggggtggagtttaggaaa
ttgggggaggtgtgtgaaagcacaaataaaaaaacactcaaaataagcgaagtgagcgaa
gtaaaaaataagggaatgtatccagtgataaattcagggagagatttgtatggttattac
catgattttaacaatgatggagaaaatataactattgcatctaggggagaatatgcagga
tttataaactacttcaatgaaaaaatttttgcagggggtctatgttatccctataaagtt
aaagatactaacgagcttttaacaaaatttttatacttttatctcaaaactaatgaaatc
caaattatggagaaccttgtttctcgtggcagtatccccgcactcaataaagcagatatt
gaaactttaacaatccccatcccacccctagaaatccaacaagagatcgttaagattttg
gatcaattcttggccctaaccaccgatttattagccggtatcccagctgaaatagaagcc
aggaaaaaacaatacgaatattacagagaaaaactactgactttcaaaccactccaaaac
aaggcataa

DBGET integrated database retrieval system