KEGG   Helicobacter pylori Sat464: HPSAT_02525Help
Entry
HPSAT_02525       CDS       T01897                                 

Definition
(GenBank) N-acetylneuraminic acid synthetase
Organism
hpt  Helicobacter pylori Sat464
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NeuB SAF
Motif
Other DBs
NCBI-ProteinID: ADO05250
Position
502196..503233
Genome map
AA seq 345 aa AA seqDB search
MDFILGTRKIGINYTPLVVAEIGINHNGSLEIAKLMVDAAKEAGIEVIKHQTHIIEDEMS
LSALKVIPGNSELSIYEIMKKCALSKNDERELKEYAEKQGLIFLSTPFSRAAANFLEDLG
VVGYKIGSGEMNNTPLLKHIANFKKPMIISTGMHDLEGVKECVSPILDKVPIALLHTTNL
YPTPFELVRLNAMLDLKNAFKVPVGLSDHTLNNNACKSALALGASIVERHFTDTKDREGP
DIVCSMDKEEAKDLVKSAQEIFLMRGGSKTKIKEEQVTRDFAFATMVAIKRIKKGEKITE
SNAWVKRPGVKGILAKDYEKTLGRVAKIDINTDEHICDEMLENKE
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atggattttattttaggcactagaaaaattggcatcaactacacgcctttagtggtagct
gaaatagggatcaaccataatggcagtttggaaatcgctaaactcatggtggatgcagct
aaagaagctggcattgaagtgatcaaacaccaaacgcacattattgaagatgaaatgagt
ttgagcgctttaaaggtcattcctggtaatagcgagttaagcatttatgaaatcatgaaa
aaatgcgctttgagcaaaaacgatgaaagggaattgaaagaatatgcagaaaaacaaggg
ctgatttttctctctacgccttttagccgagcagcagcgaattttttagaagatttaggc
gttgtgggctataaaataggctctggcgaaatgaataatacccccttattgaagcatatt
gccaactttaaaaagcccatgattatttctactgggatgcatgatttagagggcgtgaaa
gagtgtgtaagccctattttagataaagtgccaatcgctctcctccatacgacaaacctc
taccccacgccttttgaattggtgcgcttaaacgctatgctggatctaaagaacgcgttt
aaggtgccggtgggtttgagcgatcacactttaaacaataacgcttgcaagagcgcttta
gctcttggagcgagcatcgtggaacggcattttacggacactaaagacagagaggggcct
gatattgtttgctctatggataaagaagaggctaaagatttagtcaaaagtgctcaagag
atttttttaatgcgtggggggagtaagacgaaaattaaagaagaacaagtcacacgagat
tttgctttcgccactatggtggctatcaaacgcatcaaaaaaggcgaaaaaatcactgaa
agtaacgcatgggtgaaacgcccgggagttaaagggattttagcgaaggattacgaaaag
actttgggtagagtggctaaaatagacatcaatacagacgaacacatctgcgatgaaatg
ctagaaaataaggaataa

DBGET integrated database retrieval system