KEGG   Helicobacter pylori Sat464: HPSAT_02540Help
Entry
HPSAT_02540       CDS       T01897                                 

Definition
(GenBank) bifunctional alpha-2,3/-2,8-sialyltransferase
Organism
hpt  Helicobacter pylori Sat464
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CST-I MAF_flag10
Motif
Other DBs
NCBI-ProteinID: ADO05253
Position
505123..506172
Genome map
AA seq 349 aa AA seqDB search
MKKPLIIAGNGPSIKDLDYSLFPKDFEVFRCNQFYFEDKYYLGREIKGVFFNPCVLSSQM
QTAQYLMDNGEYSIERFFCSVSTDRHDFDGDYQTILPVEGYLKAHYPFVCDTFSLFKGHE
EILRHVKYHLKTYSKELSAGVLMLLSAVVLGYKEIYLVGIDFGASSWGHFYDESQSQHFS
NHMADCHNIYYDMFTICLCQKYAKLYALAPNSPLRHILALNPQAKYHFELLDKPIGYTSD
LIVSLPLEEKLLEFKNIEEKLLEFKNIEEKLLEFKNIEEKLLEFKNIEEKLLEFKNIEEK
LLEFKNIEEKLLVNRLKNILRKIKRKILPFFWGGGGNTHLKVSFRWGVA
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaacccctaatcattgccggcaatggccctagcatcaaggatttggattactct
ctgttccccaaagattttgaagtctttaggtgcaaccagttctattttgaagacaagtat
tatttggggagggaaattaagggggtgttttttaacccttgtgtgttgagttctcaaatg
cagaccgcacaatatttaatggataatggtgaatattctattgagcggtttttttgttca
gtgagcacggatcggcatgattttgatggggattaccaaacaattttgcccgttgagggg
tatttgaaggctcattatccttttgtttgcgatacttttagcttgtttaaagggcatgaa
gaaatattaaggcatgtcaaataccatttaaaaacttattctaaagaattgagtgcaggg
gttttgatgcttttgagcgcggtagttttagggtataaggagatttacttggtggggatt
gattttggagcgagctcttgggggcatttttatgatgagagccaaagccagcattttagt
aaccacatggcagattgccataatatttattacgacatgtttaccatttgcctttgtcaa
aaatacgccaagctttatgcgttagctcctaatagtccattaagacatattttagcttta
aacccacaagctaaatatcattttgaattgttagataaacccataggatatacaagcgat
ttgattgtttctttgccgcttgaagaaaagttattggaatttaaaaacattgaagaaaag
ttactggaatttaaaaacattgaagaaaaattactggaatttaaaaacattgaagaaaaa
ttactggaatttaaaaacattgaagaaaagttactggaatttaaaaacattgaagaaaag
ttattggaatttaaaaacattgaagaaaagttactagtcaatagattgaaaaatattttg
cgaaaaataaagcgtaaaattttaccatttttttgggggggggggggtaacacccaccta
aaagttagttttagatggggggttgcatga

DBGET integrated database retrieval system