KEGG   Helicobacter pylori Sat464: HPSAT_02555Help
Entry
HPSAT_02555       CDS       T01897                                 

Definition
(GenBank) bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate synthase
  KO
K13038  phosphopantothenoylcysteine decarboxylase / phosphopantothenate---cysteine ligase [EC:4.1.1.36 6.3.2.5]
Organism
hpt  Helicobacter pylori Sat464
Pathway
hpt00770  Pantothenate and CoA biosynthesis
hpt01100  Metabolic pathways
Module
hpt_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:hpt00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    HPSAT_02555
Enzymes [BR:hpt01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.36  phosphopantothenoylcysteine decarboxylase
     HPSAT_02555
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.5  phosphopantothenate---cysteine ligase (CTP)
     HPSAT_02555
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DFP Flavoprotein DUF5375
Motif
Other DBs
NCBI-ProteinID: ADO05256
Position
complement(508022..509299)
Genome map
AA seq 425 aa AA seqDB search
MNFLEDLFYPLRLLENKRVLLLVSGSIAAYKSLELVRLLFKSGASVQVVMSEGAKKFVTP
LSFEALSHHKVLHDHNEKWYYNHQNALHHNHIACATNADLLIFAPLSANSLSKIAHALAD
NIVSATFLACTSPKILAPSMNTNMLNSPIIQSHLKRLKDFNHIILDTQNGLLACDTKGNG
AMAEPLEILFKATQTLLKDAYFENREVIIMGGASMEKIDSVRTISNLSSGIQASALALAL
YFKGAKVTLIASNFPTPLPKEIASVLVSDTKSYENALNNASNNLQKHALKPLLFNLAAIS
DYVPKTSFNHKLKKSELGETLNIECVQNRDLLASINPNQFVKIGFKAEDDQQNAIKNAQN
LLKPSQDNGKGCSMVALNLIKDSRPFGSLENELWLFSHHKTQKIPSMNKLEASFKILDFI
KDNAL
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgaattttttagaagatttgttttaccccttaagattattagaaaacaagcgcgtttta
ttgcttgtgagcggctctattgcggcgtataaatccctagaattagtgcgtttgttgttt
aaaagcggggctagtgttcaagtggtgatgagtgagggcgcaaaaaaatttgttacgccc
ttaagctttgaagccttgagccatcacaaggttttgcatgatcataatgaaaaatggtat
tacaaccaccaaaacgcattgcaccataaccacatcgcatgcgctactaatgctgattta
ctcatctttgcccccttaagcgctaacagcctgtctaaaatcgctcacgctttagcggat
aatatcgtaagcgcgacttttttggcttgcacttcccctaaaatcctagcccctagcatg
aacaccaacatgctcaattcccctatcattcaaagccatttaaaacgcttgaaagatttc
aaccatattattttagacacgcaaaacggccttttagcatgcgatactaaaggtaatgga
gcgatggctgagcctttagaaatcctttttaaagccacgcaaacgctcttaaaagacgct
tattttgaaaacagagaagtcataatcatgggcggcgcaagtatggaaaagattgacagc
gttcgaacgatcagcaacctttctagcgggatccaagcgagcgctttagctctagcgttg
tattttaagggagcgaaagtaactttgattgcatcaaacttccctacccccttgcctaaa
gaaatcgcaagcgttctagtcagcgatactaaatcttatgaaaacgccttgaataacgcc
tctaacaacctgcaaaaacatgccttaaaacccctactctttaatttagccgccattagc
gattatgtgcctaaaacttcttttaaccataagcttaaaaaaagcgaactgggcgaaacc
ctaaacattgaatgcgttcaaaatagggatttactggcttctatcaatcccaatcaattc
gttaaaatcggctttaaagccgaagacgatcaacaaaacgccatcaaaaacgctcaaaat
cttttaaaaccttctcaagataacggcaagggttgctccatggttgctttgaatctcatt
aaagattcacgcccttttggctcattagagaatgaattgtggctctttagccatcacaaa
acccaaaaaatcccttctatgaacaaattagaagcgagctttaaaatccttgattttatc
aaagacaacgccctttaa

DBGET integrated database retrieval system