KEGG   Helicobacter pylori Sat464: HPSAT_02560Help
Entry
HPSAT_02560       CDS       T01897                                 

Definition
(GenBank) UDP-GlcNAc C6 dehydratase
  KO
K15894  UDP-N-acetylglucosamine 4,6-dehydratase [EC:4.2.1.115]
Organism
hpt  Helicobacter pylori Sat464
Pathway
hpt00520  Amino sugar and nucleotide sugar metabolism
Brite
KEGG Orthology (KO) [BR:hpt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    HPSAT_02560
Enzymes [BR:hpt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.115  UDP-N-acetylglucosamine 4,6-dehydratase (configuration-inverting)
     HPSAT_02560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Polysacc_synt_2 Epimerase 3Beta_HSD GDP_Man_Dehyd RmlD_sub_bind NAD_binding_4 NAD_binding_10 adh_short Sacchrp_dh_NADP KR NmrA Shikimate_DH NAD_binding_7 F420_oxidored
Motif
Other DBs
NCBI-ProteinID: ADO05257
Structure
PDB: 

Position
complement(509296..510279)
Genome map
AA seq 327 aa AA seqDB search
MLDNQTILITGGTGSFGKRFARKVLDTTNAKKIIVYSRDELKQSEMAMEFNDPRMRFFIG
DVRDLERLNYALEGVNICIHAAALKHVPIAEYNPLECIKTNIMGASNVINACLKNEVSQV
IALSTDKAANPINLYGATKLCSDKLFVSANNFKGSSQTQFSVVRYGNVVGSRGSVVPFFK
KLVQNKASEIPITDIRMTRFWITLDEGVSFVLKSLKRMHGGEIFVPKIPSMKMTDLAKAL
APNTPTKIIGIRPGEKLHEVMIPKDESHLALEFEDFFIIQPTISFQTPKDYTLTKLHEKG
HKVAPDFEYSSHNNSKWLEPDDLLKLL
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgctagacaatcaaacgattttaatcaccggtggcactgggagttttggcaaacgcttt
gcacgtaaagttttagacaccaccaacgctaaaaaaatcattgtttatagccgagatgaa
ttaaagcaaagcgaaatggcaatggaatttaatgatcctaggatgcgtttttttatcggc
gatgtgagggatttagagcgcttgaattacgctttagagggcgtaaatatttgcatccat
gccgccgcgcttaagcatgttcccatcgctgaatacaaccccctagaatgcattaaaacc
aatatcatgggcgcaagcaacgtgattaacgcatgcctaaaaaatgaagtgagccaggtc
atcgccctaagcaccgataaagccgctaaccccattaacctctacggtgcgacgaaattg
tgcagcgacaagctctttgtgagcgcgaataacttcaaaggctcttctcaaacgcaattt
agcgtggtgcgttatggtaatgtggtggggagtcgtgggagcgtggtgccgttttttaaa
aaactagtccaaaacaaagcgagtgaaatccccattacagatattcgcatgacacgattt
tggatcaccttagatgagggggtttcttttgtgcttaaaagcttgaaaagaatgcatggg
ggtgagatttttgtgcctaaaatccctagcatgaaaatgactgatctcgctaaagcccta
gcccccaatacccctactaaaatcatagggattcgtccgggcgaaaaactccatgaagtg
atgatccctaaagatgaaagccatttagcgctagaatttgaagactttttcatcattcag
cccactataagcttccaaacgcctaaagattacacgctcaccaaactccacgaaaaaggc
cacaaagtcgcccctgattttgaatacagcagccataataacagcaaatggctagagcct
gatgatttattgaaattgctatga

DBGET integrated database retrieval system