KEGG   Helicobacter pylori Sat464: HPSAT_02595Help
Entry
HPSAT_02595       CDS       T01897                                 

Definition
(GenBank) hypothetical protein
Organism
hpt  Helicobacter pylori Sat464
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ADO05264
Position
515839..516723
Genome map
AA seq 294 aa AA seqDB search
MFLVKKIGMVVVVLIGFLACSQERFIQLQKKAQEQENDGSKRPSYVDSDHEVFSETIFLQ
NMVHQPTEERDAFAQLTKDEDDSFNPEASVILLNEPSDNDTKNPPLNQNESDNNTNTANN
DAKNPFLYKPKRKTKDPKLIEYSQQNFYPLKDGDIVMSKEGDQWLIEIKSKALKRFLKDQ
NDKDRQIQTFTFNDTKTQIAQFKGKISSYVYTTNNSDLSLRPFYESFLLEKKSDDLYTIG
DKALDAIEIQKCQMVLKKHSTDKLDSQHKAISIDLDFKKERFKSDTELFLECQS
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
ttgtttttagtcaaaaaaataggcatggtagtagtggttttaataggctttttagcttgc
tcgcaagagaggtttatccagttgcaaaaaaaagcccaagagcaagaaaatgacggctct
aaacgccctagctatgtggattcggatcatgaagtctttagcgaaacgatttttttacaa
aacatggtgcatcagcctacagaagaaagagacgcttttgctcaactgactaaagatgaa
gacgattcttttaatcccgaagcttctgtgattttattgaatgagccaagcgataacgat
acaaaaaacccgcccttaaaccaaaatgagtctgacaataatactaacactgccaataac
gatgcaaaaaacccgttcctttacaaaccgaaaagaaaaacaaaagatccaaaactcatt
gaatattcccaacaaaatttctaccccctaaaggatggggatattgttatgagtaaagaa
ggggatcaatggctgatagaaatcaaatccaaagccttgaagcgttttttaaaagatcaa
aacgataaagatcgccagatccaaactttcacttttaatgacactaaaacgcaaatcgcg
caatttaagggcaaaatttcttcgtatgtttataccaccaataacagcgatttgagttta
aggcctttttatgaatcctttctcttagaaaaaaagagcgatgatctttatacgataggg
gataaggctttagacgccattgaaattcaaaagtgtcaaatggtgttaaagaagcattca
accgacaaattagacagccaacataaagccatcagtattgatttggattttaaaaaagag
cgctttaagagcgatacggaactttttttagaatgccaaagctag

DBGET integrated database retrieval system