KEGG   Helicobacter pylori Sat464: HPSAT_02630Help
Entry
HPSAT_02630       CDS       T01897                                 

Definition
(GenBank) RNA binding protein
Organism
hpt  Helicobacter pylori Sat464
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RRM_1 RRM_5 DbpA DUF4974
Motif
Other DBs
NCBI-ProteinID: ADO05271
Structure
PDB: 

Position
522185..522433
Genome map
AA seq 82 aa AA seqDB search
MKNIYVGNLVYSATSEQVKELFSQFGKVFNVKLIYDRETKKPKGFGFVEMQEEGVSEAIA
KLDNTDFMGRTIRVTEANPKKF
NT seq 249 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaaacatttatgtagggaatttggtttatagtgctaccagcgagcaagtcaaggag
cttttcagtcaatttggcaaagtttttaatgtcaagctaatttatgacagagaaacgaag
aaacctaaaggttttggctttgtggaaatgcaagaagagggcgttagtgaagcgattgct
aaattagacaatacggattttatgggcagaacgattagggtaactgaagctaatcctaaa
aagttttag

DBGET integrated database retrieval system