KEGG   Helicobacter pylori Sat464: HPSAT_02645Help
Entry
HPSAT_02645       CDS       T01897                                 

Definition
(GenBank) thioredoxin
  KO
K03671  thioredoxin 1
Organism
hpt  Helicobacter pylori Sat464
Brite
KEGG Orthology (KO) [BR:hpt00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:hpt03110]
    HPSAT_02645
Chaperones and folding catalysts [BR:hpt03110]
 Protein folding catalysts
  Protein disulfide isomerase
   HPSAT_02645
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thioredoxin Thioredoxin_2 Thioredoxin_9 Thioredoxin_8 Thioredoxin_3 HyaE Redoxin TraF AhpC-TSA Phosducin Glutaredoxin Thioredoxin_6 OST3_OST6 DUF836
Motif
Other DBs
NCBI-ProteinID: ADO05274
Structure
PDB: 

Position
complement(524566..524886)
Genome map
AA seq 106 aa AA seqDB search
MSHYIELTEENFESTIKKGVALVDFWAPWCGPCKMLSPVIDELASEYEGKAKVCKVNTDE
QEELSAKFGIRSIPTLLFTKDGEVVHQLVGVQTKVALKEQLNKLLG
NT seq 321 nt NT seq  +upstreamnt  +downstreamnt
atgagtcactatattgaattaactgaagaaaattttgaaagcaccattaaaaaaggggtt
gcgttagtggatttttgggcgccatggtgtgggccttgcaagatgctatcccctgtgatt
gatgaattagctagcgaatatgaaggtaaggccaaggtttgtaaggtcaataccgatgag
caagaagaactgagcgcaaaatttggtattagaagcattcctacgcttttattcacaaaa
gatggcgaagtcgtccatcagttggtgggtgtgcaaactaaagttgctttaaaagagcaa
ttgaacaaacttctaggctag

DBGET integrated database retrieval system