KEGG   Helicobacter pylori Sat464: HPSAT_02670Help
Entry
HPSAT_02670       CDS       T01897                                 

Definition
(GenBank) hypothetical protein
Organism
hpt  Helicobacter pylori Sat464
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ADO05279
Position
528836..529015
Genome map
AA seq 59 aa AA seqDB search
MFHKLILTCFLTLVAITIQACGYKAPPFNEKPAKKTSNSSNSSMQTPTNNTTPEFLNQP
NT seq 180 nt NT seq  +upstreamnt  +downstreamnt
ttgttccataaactgatcttaacatgctttttaacgcttgtagcaataacgattcaagct
tgcggctataaagcccccccattcaatgaaaaacccgctaaaaaaacttcaaacagctct
aattcttctatgcaaacgcccaccaacaacaccacgccagaatttttaaatcagccttaa

DBGET integrated database retrieval system