KEGG   Helicobacter pylori Sat464: HPSAT_02680Help
Entry
HPSAT_02680       CDS       T01897                                 

Definition
(GenBank) osmoprotection protein (proWX)
  KO
K05845  osmoprotectant transport system substrate-binding protein
K05846  osmoprotectant transport system permease protein
Organism
hpt  Helicobacter pylori Sat464
Pathway
hpt02010  ABC transporters
Module
hpt_M00209  Osmoprotectant transport system
Brite
KEGG Orthology (KO) [BR:hpt00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    HPSAT_02680
Transporters [BR:hpt02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Osmoprotectant transporter [MD:M00209]
    HPSAT_02680
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OpuAC BPD_transp_1 DUF4105
Motif
Other DBs
NCBI-ProteinID: ADO05281
Position
complement(529672..531333)
Genome map
AA seq 553 aa AA seqDB search
MPSMGVFKHLFKELHEWLLHSVDVMTQHLVAVLLKISVVKHLIQEFHDRFIYFIDLLAQH
FIIVALSSFLVLVFGVLIGVFVFYNSKARAFLLPIVNFLYTIPSLALFALFIPLIGVGLK
NALLVLVLYGLLPIVHSTYNALKEVREEVIKAAIGLGCNPKELFFRVRFLLAIPQILVGL
RIAVVMLVAMAGIGALIGAGGLGQAIFRGLNTQNTTLLVAGSLIIALFSVLADQFVSVFQ
HENALQRLFSQNATKKQKRKVYLNLAVFLFLLLASALWLIPRNAIEEKPLVVATKPSSEQ
YILGEILSLLLEKHHIPIKRAFGIGGGTMNIHPALIRGDFDLYVEYTGTAWVNTLKNPLT
QKVDFETIKKRYEKEFNLLWVGLLGFNNTYSLAISKEDAQKYAIETFSDLAFHSPNFDFG
AEFDFFEREDAFKGLVKAYPFHFRSLHEMDINLRYKSFESHKINALDVFTTDAQIKELDL
KVLKDDKGFFPNYQAGIVMRKEIVKKYPEALKILEKLDSKFSDEVMQDLNYQVEVLKKSP
QIVAKEFLERLGL
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atgccaagcatgggcgtttttaaacatttattcaaagaattgcatgaatggttgctccat
tctgtagatgtaatgacacagcatttagttgccgtattgttaaaaataagcgtggtaaaa
catttgatacaagaatttcatgatcgtttcatttattttatagatttactcgcgcagcat
tttatcatcgttgcgctctctagctttcttgtgctggtgtttggggttttgattggggtt
tttgtgttttacaactcaaaggctagggcgttcttgctccctatagtgaatttcctctac
accatcccatcgcttgcgttatttgcgttattcattcctttaattggggtggggttaaaa
aacgcgcttttagtgttggtcttatacggcttattacccattgtccatagcacttataac
gctttaaaagaggtgagagaagaggtgattaaggccgctatcgggctagggtgtaaccca
aaagagttgttttttagggtgcgattcttgctcgctatcccccaaattttagtgggctta
aggattgcggtggtgatgctagtagcgatggctgggattggggcgctcattggggctggg
ggcttagggcaggcgatttttagagggctaaacacgcaaaacaccacgcttttagtggcg
ggcagtttgatcattgctctttttagtgttttagcggatcaatttgtgagcgtctttcag
catgaaaacgccttgcaacgcctattttctcaaaacgccaccaaaaaacaaaaaagaaaa
gtttatcttaatttagcggtgttcctttttttattgctagcgagcgctttatggctcatt
cctagaaacgccatagaagaaaagcccttagtcgtggcgacaaaacctagcagcgagcag
tatattttgggcgagattttaagccttttgttagaaaaacaccatatccctatcaagcga
gcgtttggcattggtggggggacgatgaatatccatccggcattaattaggggcgatttt
gatttgtatgtggaatataccggcaccgcttgggtgaatacgctcaaaaaccctttgact
caaaaagtggattttgaaacgattaaaaagcgttatgagaaggaattcaatcttttatgg
gtggggcttttgggttttaataacacctattccttagcgatttctaaagaagacgctcaa
aaatacgctattgaaactttcagcgatttagcctttcatagcccaaattttgattttgga
gcagagtttgacttttttgaaagagaggacgcttttaaaggcttagtgaaagcctatcca
ttccattttagaagtttgcatgaaatggatattaatttgcgctataaaagttttgaatcc
cataaaatcaacgctttagatgtcttcactacagacgctcaaatcaaagagctggattta
aaggtgcttaaggacgataaagggtttttccccaattatcaggccggtattgttatgaga
aaagaaattgtaaaaaagtatccggaagcgttaaaaatcttagaaaaattggattcaaaa
tttagcgatgaggtgatgcaagatttaaactatcaggtggaagtgttgaaaaaaagcccc
caaatagtcgctaaagagtttttagaaagattggggttataa

DBGET integrated database retrieval system