KEGG   Helicobacter pylori Sat464: HPSAT_02700Help
Entry
HPSAT_02700       CDS       T01897                                 

Definition
(GenBank) thiamin biosynthesis protein (thiF)
Organism
hpt  Helicobacter pylori Sat464
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ThiF Shikimate_DH Sacchrp_dh_NADP NAD_binding_7
Motif
Other DBs
NCBI-ProteinID: ADO05285
Position
complement(533513..534280)
Genome map
AA seq 255 aa AA seqDB search
MLSRLEKERYLRHIMLEDVGEEGQLKLLKSSVLVVGAGGLGSAVLMYLCAAGIGKIGIVD
FDMVDMSNLQRQIIHSQDFLNQSKASSAKARLKQLNAGIEIETFEEHFKAHNALSLIEPY
DFIIDATDNFNAKFLINDACVLAQKPYSHAGVLKYRGQSMSVLPNSACLACVFDKPPKKG
LNPISGLFGVLPGVLGCIQASECLKYFLGFETLLINTLLIADIKTMDFKKIQAPKNPECR
VCGTHKITHLQDYEI
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
ttgttaagccggctagaaaaggagcgttatttgcgccatatcatgctagaagatgtgggc
gaagaaggccaattgaagcttttaaaatctagcgttttagtcgttggggctgggggtctt
ggatcagcggttttgatgtatttgtgcgctgctgggataggaaaaatcggtattgtggat
tttgatatggtagatatgagtaatttgcaacgccaaattatccattcacaggatttttta
aaccaatctaaagcctctagcgctaaagcacgcttaaaacaactcaatgcgggtattgaa
atagagacttttgaagaacactttaaggctcataacgctctttctctcatagagccttat
gattttatcatagacgctacagacaatttcaacgctaaatttttgattaatgacgcttgc
gtgttagcccaaaaaccctattcgcatgccggggttttaaaatacagggggcaaagcatg
agcgttttacccaatagcgcatgcttagcgtgtgtttttgataagccccctaaaaaggga
ttaaatcctatttcagggctttttggggtcttacccggagttttagggtgtatccaagcg
agcgaatgccttaaatattttttagggtttgaaactttacttataaatactttacttata
gccgatattaaaacgatggattttaaaaaaattcaagcacccaaaaaccctgaatgtagg
gtttgtggcacgcataaaatcacgcatttacaagattatgaaatttag

DBGET integrated database retrieval system