KEGG   Helicobacter pylori Sat464: HPSAT_02725Help
Entry
HPSAT_02725       CDS       T01897                                 

Definition
(GenBank) hypothetical protein
Organism
hpt  Helicobacter pylori Sat464
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cons_hypoth95 RsmJ MethyltransfD12
Motif
Other DBs
NCBI-ProteinID: ADO05290
Position
536797..537399
Genome map
AA seq 200 aa AA seqDB search
MPNHQPVKKFKIIGGACKGLGLNLPKISSTRPTKAIVRESFFNTLQAEIRGAHFIEVFSG
SASMGLEALSRGAKSAVFFEQNKSAYATLLENISLCKNRLKKEIEIQTFLDDAFKLLPAL
CLKNGVLNILYFDPPFETSGFLGIYEKCFQALEMLLKRFNPKNLLVVFEHESVHAMPKSL
VTLAIIKQKKFGKTTLTYFQ
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgccaaatcatcagccagtaaaaaaatttaagattattgggggggcttgtaagggattg
ggcttgaatttgcccaaaatttctagcacgcgccccacaaaagcgatcgtaagagagtcg
ttttttaacaccttgcaagcagaaattaggggagcgcattttatagaagtgttttcaggc
agcgcttctatgggtttagaggctttgagtaggggggctaaaagcgcggtgttttttgag
caaaataaaagcgcttatgccacgcttttagaaaatatttccctttgtaaaaaccgcctg
aaaaaggaaattgaaattcaaacctttttagatgacgctttcaagcttttgcccgctctg
tgtttaaaaaatggcgttttgaatatcctttattttgatcctccttttgaaacaagcggg
tttttagggatttatgaaaagtgttttcaagctttagaaatgttattgaaacgctttaat
ccaaaaaatcttttagtggtttttgaacatgaaagcgtgcatgcaatgcctaaaagtctt
gtaactttagctataatcaaacagaaaaaatttggaaaaaccactttaacttattttcaa
tag

DBGET integrated database retrieval system