KEGG   Helicobacter pylori Sat464: HPSAT_02770Help
Entry
HPSAT_02770       CDS       T01897                                 

Definition
(GenBank) molybdopterin converting factor, subunit 1 (moaD)
  KO
K03636  sulfur-carrier protein
Organism
hpt  Helicobacter pylori Sat464
Pathway
hpt04122  Sulfur relay system
Brite
KEGG Orthology (KO) [BR:hpt00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04122 Sulfur relay system
    HPSAT_02770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ThiS RILP
Motif
Other DBs
NCBI-ProteinID: ADO05299
Position
542923..543144
Genome map
AA seq 73 aa AA seqDB search
MVEVRFFGPIKEENFFIKVSDLKELRAILQEKEGLKEWLGVCAIALNDRLIDNLNTPLKE
GDVVSLLPPVCGG
NT seq 222 nt NT seq  +upstreamnt  +downstreamnt
atggtagaagtgcgattttttggacccataaaagaagaaaattttttcatcaaagtgagt
gatttaaaggaattaagagcgattttacaagaaaaagagggcttaaaagagtggttgggc
gtttgcgcgatagcccttaatgatcgtttaatagacaatttaaacacgcctttaaaagag
ggcgatgtggtaagcttgttgccgccggtttgtgggggctag

DBGET integrated database retrieval system