KEGG   Helicobacter pylori Sat464: HPSAT_02775Help
Entry
HPSAT_02775       CDS       T01897                                 

Definition
(GenBank) molybdopterin converting factor, subunit 2
  KO
K03635  molybdopterin synthase catalytic subunit [EC:2.8.1.12]
Organism
hpt  Helicobacter pylori Sat464
Pathway
hpt00790  Folate biosynthesis
hpt01100  Metabolic pathways
hpt04122  Sulfur relay system
Brite
KEGG Orthology (KO) [BR:hpt00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    HPSAT_02775
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04122 Sulfur relay system
    HPSAT_02775
Enzymes [BR:hpt01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.12  molybdopterin synthase
     HPSAT_02775
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MoaE
Motif
Other DBs
NCBI-ProteinID: ADO05300
Position
543145..543582
Genome map
AA seq 145 aa AA seqDB search
MLKIIQGALDTDKLLKAYQEEACTKNFGAFCVFVGIVRGENNIQGLSFDIYEALLKTWFE
KWHHKARDLGVVLKMAHSLGDVLIGQSSFLCVLMGKNRKNALELYQDFIEDFKHNAPIWK
YDLIHNKRIYAKERSHLLKGSGLLA
NT seq 438 nt NT seq  +upstreamnt  +downstreamnt
gtgttaaaaatcattcaaggggcattagatactgacaagcttttaaaagcctaccaagag
gaagcttgcacgaaaaactttggagcgttttgcgtgtttgttgggattgtgagaggagag
aataacattcaaggcttgagttttgatatttatgaagcgctattaaagacttggtttgaa
aaatggcaccataaagccagagatttgggcgtggtgttaaaaatggcgcacagcttgggc
gatgttttgataggacaaagctcatttttatgcgttttaatgggaaagaatagaaaaaat
gccttagaactataccaagattttattgaagattttaagcataacgcccctatttggaaa
tacgatttaatccacaataaacgcatctacgctaaagaaagaagccaccttttaaaaggg
agtgggcttttagcttaa

DBGET integrated database retrieval system