KEGG   Helicobacter pylori Sat464: HPSAT_02780Help
Entry
HPSAT_02780       CDS       T01897                                 

Gene name
mogA
Definition
(GenBank) molybdenum cofactor biosynthesis protein MogA
  KO
K03831  molybdopterin adenylyltransferase [EC:2.7.7.75]
Organism
hpt  Helicobacter pylori Sat464
Pathway
hpt00790  Folate biosynthesis
hpt01100  Metabolic pathways
hpt04122  Sulfur relay system
Brite
KEGG Orthology (KO) [BR:hpt00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    HPSAT_02780 (mogA)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04122 Sulfur relay system
    HPSAT_02780 (mogA)
Enzymes [BR:hpt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.75  molybdopterin adenylyltransferase
     HPSAT_02780 (mogA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MoCF_biosynth
Motif
Other DBs
NCBI-ProteinID: ADO05301
Structure
PDB: 

Position
543595..544125
Genome map
AA seq 176 aa AA seqDB search
MQTIHIGVLSASDRASKGIYEDLSGKAIQEVLSEYLLNPLEFHYEIVADERDLIEKSLIK
MCDEYQCDLVVTTGGTGPALRDITPEATEKVCQKMLPGFGELMRMTSLKYVPTAILSRQS
AGVRNKSLIVNLPGKPKSIRECLEAVFPAIPYCVDLILGNYMQVNEKNIQAFRPKQ
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
atgcaaacgattcatataggcgttttgagcgcgagcgatagagcgtcaaaagggatttat
gaagatttaagcggtaaagcgatacaagaagtgttgagcgaatatctgcttaatccttta
gaatttcattacgaaattgtcgctgatgaaagggatttaattgaaaaatcgctgattaaa
atgtgcgatgaataccaatgcgatctagtcgttactacaggaggcacaggccctgctcta
agagatataaccccagaagccacagaaaaagtgtgccaaaaaatgcttcctggttttgga
gagcttatgcgaatgactagtttaaaatatgtgcctacagcgattctatcgcgccagagc
gctggtgttaggaataagagtttgattgtcaatctccctggtaagccaaaaagtattaga
gaatgcttagaagcggtttttccagcgattccttattgcgtggatttgattttaggaaat
tatatgcaagtgaatgaaaaaaacattcaagcgtttcgccccaaacaataa

DBGET integrated database retrieval system