KEGG   Helicobacter pylori Sat464: HPSAT_02785Help
Entry
HPSAT_02785       CDS       T01897                                 

Gene name
moaC
Definition
(GenBank) molybdenum cofactor biosynthesis protein MoaC
  KO
K03637  cyclic pyranopterin monophosphate synthase [EC:4.6.1.17]
Organism
hpt  Helicobacter pylori Sat464
Pathway
hpt00790  Folate biosynthesis
hpt01100  Metabolic pathways
hpt04122  Sulfur relay system
Brite
KEGG Orthology (KO) [BR:hpt00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    HPSAT_02785 (moaC)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04122 Sulfur relay system
    HPSAT_02785 (moaC)
Enzymes [BR:hpt01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.17  cyclic pyranopterin monophosphate synthase
     HPSAT_02785 (moaC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MoaC
Motif
Other DBs
NCBI-ProteinID: ADO05302
Position
544134..544610
Genome map
AA seq 158 aa AA seqDB search
MPLTHLNEENQPKMVDIGDKETTERIALASGRISMNKEAYDAIVNHCVKKGPVLQTAIIA
GIMGAKKTSELIPMCHSIMLNGVDIDILEEKETHSFKLYARVKTQAKTGVEMEALMSVSI
GLLTIYDMVKAIDKSMTISGVMLEHKSGGKSGDYNAKK
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atgccgctcactcatttgaatgaagaaaatcagcctaaaatggtggatataggggataag
gaaaccactgaaagaatcgctttagcaagcggtcgtatcagcatgaataaagaggcttat
gacgctattgttaatcattgcgtcaaaaagggtccggtgttacagactgctattattgct
gggattatgggagctaaaaagacaagcgagctcattcccatgtgccattcaatcatgctc
aatggggtggatattgatattttagaagaaaaagaaactcatagttttaaactctatgcg
agagtcaaaactcaagctaaaacgggcgtagaaatggaagcgttaatgagtgtgagcata
gggcttttaaccatttatgacatggtgaaagccattgataagagcatgacaattagcggt
gtgatgttggagcataaaagtggaggcaaaagtggggattataacgctaaaaaatag

DBGET integrated database retrieval system