KEGG   Helicobacter pylori Sat464: HPSAT_02805Help
Entry
HPSAT_02805       CDS       T01897                                 

Definition
(GenBank) Transposon IS607 OrfB
  KO
K07496  putative transposase
Organism
hpt  Helicobacter pylori Sat464
Brite
KEGG Orthology (KO) [BR:hpt00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99976 Replication and repair
    HPSAT_02805
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OrfB_IS605 OrfB_Zn_ribbon HTH_OrfB_IS605 tRNA-synt_1f C1_2 Zn_Tnp_IS1595
Motif
Other DBs
NCBI-ProteinID: ADO05306
Position
546391..547650
Genome map
AA seq 419 aa AA seqDB search
MSAISITHKIALKPNNKHITYFKKAFGCARFAYNWGLAKWKENYQLGIKTNHLQLKKEFN
ALKKSQFNFVYEVTKYATQQPFIHLNLAFNKFFRDLKKGLVSYPKFKKKREFQGSFYIGG
DQIKIIQTANTGYLKIPNLPPIKLTEKLRFQGKINNATITQKGDHFYVSISCGVDESEYK
RTHKLQESHNKLGVDIGIKSFVSLSNGLNIYAPKPLDKLTRKLVRISRQLSKKIHPKTKG
DKTKKSNNYLKHSKKLTHLHEKIANIRLDFLHKLTSSLIRHSNSFCLESLKVKNMFKNHR
LAKSLSDVSMSVFNTLLEYKAKYSNKEILRADTYYPSSKTCSNCQKVKQDLKLKDRIYQC
LECGFELDRDINAAINLLKHLVGRVTAEFTPMDLTALLNDLSKNRLATSKVELGIQQKP
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgtcagctatctcaatcacgcataaaatcgctttaaagcctaataacaagcatattact
tactttaaaaaagcttttgggtgcgctaggttcgcttataattgggggttagctaaatgg
aaagaaaactaccaactgggtattaaaactaaccatctacagcttaaaaaagaatttaac
gctcttaaaaaatcgcaatttaatttcgtttatgaagtaactaaatacgccacccaacag
ccttttatccacttaaatctagcctttaataagttttttagggatttgaaaaaaggttta
gtgagttaccctaaatttaaaaagaaaagagagtttcaaggttctttttatatagggggc
gaccaaattaaaatcattcaaacagctaatactggttatttaaaaatacctaacttacca
ccaatcaaactcactgaaaaactaagatttcaaggcaaaatcaataacgctaccatcact
caaaagggcgatcatttctatgtttcaatctcttgtggtgttgatgagagtgaatacaaa
cgaacccataaactccaagagagtcataataaactaggggttgatatagggattaaatcc
tttgtgagtttgtctaatggcttaaatatctatgcccctaagcccttagataagcttact
agaaagcttgtaagaattagcagacaactgagtaaaaaaatccacccaaaaaccaaaggg
gataaaaccaagaaatctaataattacttaaagcattctaaaaagcttacccacttgcat
gaaaaaatcgctaacatcagacttgattttttacacaagctcacaagctctcttataaga
cactcaaactcgttttgtttagagagtttgaaagtcaaaaacatgtttaaaaatcacagg
ttggctaaatccttaagcgatgtttctatgtctgtgtttaacacgctattagagtataaa
gctaaatactctaataaagaaattctaagagctgacacttactatccaagctctaagact
tgttctaattgtcaaaaggttaaacaagatttaaaacttaaagataggatttatcaatgc
ctagagtgtggctttgaattagatagagatataaacgctgctatcaatcttttaaagcat
ttagtaggtagagttactgccgaatttacgcctatggacttgacagctctgttgaatgat
ttatccaaaaatcgtttagcaactagcaaggttgaactaggaatacaacaaaaaccctaa

DBGET integrated database retrieval system