KEGG   Helicobacter pylori Sat464: HPSAT_02815Help
Entry
HPSAT_02815       CDS       T01897                                 

Gene name
tig
Definition
(GenBank) trigger factor
  KO
K03545  trigger factor
Organism
hpt  Helicobacter pylori Sat464
Brite
KEGG Orthology (KO) [BR:hpt00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99975 Protein processing
    HPSAT_02815 (tig)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trigger_C Trigger_N FKBP_C DUF3879 Tox-REase-5 Mito_carr
Motif
Other DBs
NCBI-ProteinID: ADO05308
Position
548511..549866
Genome map
AA seq 451 aa AA seqDB search
MNLEVKKIDTANARLSAKLSVENLEKRYDKIAQKIAPKVKIDGFRRGKVPLSLVKTRYQA
QIEQDAQEEMIQEVLKNALKELGIENKDLIGSPNFTKFEKKDTHFEIEADIGLKPTIVLD
KIKECVPSVGVEIPNEEKIDERLKQLAKDYAKFVDTDAQRKAQNDDKLTIDFEGFIDNAP
FEGGKAENFSLILGSKQMLEDFEKALLGMQAGEEKEFPLTFPSEYHAEHLAGKEALFKVK
LHQIQAREALEINDELAKIVLANEENAALKLLKERVEGQLFLENKARLYNEELKEKLIEN
LDEKIVFDLPKTIIEQEMDLLFRNALYSMQAEEVKSLQESQEKAKEKRESFRNDATKSVK
ITFIIDALAKEEKIGVHDNEVFQTLYYEAMMTGQNPENLIEQYRKNNMLAAVKMAMIEDR
VLTYLLDKNLPKEQQEILEKMRPNAQKTQVG
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgaatcttgaagtgaaaaagattgacaccgctaacgcccgtttgagtgctaaactttcc
gttgaaaatttagaaaagcgttatgataaaatcgctcaaaaaatcgccccaaaagttaaa
attgatggctttagaagaggtaaagtcccccttagtttagtgaaaacccgttatcaagcc
caaattgaacaagacgctcaagaagaaatgattcaagaggttttaaaaaacgctcttaaa
gaattagggattgaaaataaggatttaatcggtagccccaacttcactaaatttgaaaaa
aaagacacgcattttgaaatagaagcggacatcggcttaaaacccacgattgttttagac
aagatcaaagagtgcgtgcctagcgtgggagtggaaattccaaatgaagaaaaaattgat
gagcgtttgaaacagctcgctaaagactatgcgaaatttgtggatactgacgctcaaaga
aaagctcaaaacgacgataaattaacgattgattttgaaggttttatagataatgcgcct
tttgaagggggcaaggctgagaatttcagtttgattttaggcagtaagcaaatgctagaa
gattttgaaaaggctcttttaggcatgcaagcgggcgaagaaaaagaattccctttgact
ttccctagcgaataccacgcagagcatttggccggcaaagaagccctttttaaagtgaaa
ttacaccagattcaagcgcgtgaagcgttagaaatcaatgacgaactcgctaaaatcgtg
ctggctaatgaagagaatgcggctttaaagcttttaaaagaaagggttgaagggcagttg
tttttagaaaataaagccaggctctataatgaagagttgaaagaaaaattgattgaaaat
ttagatgaaaaaattgtttttgatttgcctaaaacgatcatagagcaagaaatggatttg
ttgttcaggaacgctctttattccatgcaagctgaggaagtcaaatccttacaagaaagt
caagaaaaagccaaagaaaagcgtgagagctttaggaatgatgcgacaaaaagcgtgaaa
atcacttttatcattgacgctttagcgaaagaagaaaaaattggcgtgcatgacaatgaa
gtctttcaaactttgtattatgaagcgatgatgacagggcaaaacccagaaaatctcatt
gaacaataccgcaaaaacaacatgttagcggcggtgaaaatggcgatgattgaagatagg
gtgctgacttatttgttggataaaaacctgcctaaagagcaacaagaaattttagagaaa
atgaggcccaacgctcaaaaaactcaagtgggttaa

DBGET integrated database retrieval system