KEGG   Helicobacter pylori Sat464: HPSAT_02820Help
Entry
HPSAT_02820       CDS       T01897                                 

Gene name
clpP
Definition
(GenBank) ATP-dependent Clp protease proteolytic subunit
  KO
K01358  ATP-dependent Clp protease, protease subunit [EC:3.4.21.92]
Organism
hpt  Helicobacter pylori Sat464
Brite
Enzymes [BR:hpt01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.92  endopeptidase Clp
     HPSAT_02820 (clpP)
Peptidases [BR:hpt01002]
 Serine Peptidases
  Family S14: ClpP endopeptidase family
   HPSAT_02820 (clpP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CLP_protease
Motif
Other DBs
NCBI-ProteinID: ADO05309
Structure
PDB: 

Position
549887..550474
Genome map
AA seq 195 aa AA seqDB search
MGYIPYVIENTDRGERSYDIYSRLLKDRIVLLSGEINDSVASSIVAQLLFLEAEDPEKDI
GLYINSPGGVITSGLSIYDTMNFIRPDVSTICIGQAASMGAFLLSCGAKGKRFSLPHSRI
MIHQPLGGAQGQASDIEIISNEILRLKGLMNSILAQNSGQSLEQIAKDTDRDFYMSAKEA
KEYGLIDKVLEKNVK
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgggatacattccttatgtaatagagaataccgatcgtggggagcgcagctatgatatt
tactcgcgccttttaaaggatcgcattgttttattgagcggtgagatcaatgatagcgtg
gcgtcttctattgtggcccaactcttgtttttggaagctgaagaccctgaaaaagacatt
ggcttgtatatcaattctcccggtggggtgataacaagcggtcttagtatttatgacacc
atgaattttatccgccctgatgtttccacgatttgcatcggtcaagcggcttctatgggg
gcgtttttactgagctgtggggctaagggcaagcgcttttcactaccccattcaaggatt
atgatccaccagcctttagggggggcccaagggcaagcgagcgatattgaaatcatttct
aatgagattctcaggcttaagggtttgatgaattctattttggctcaaaactcagggcag
agtttggagcaaatcgctaaagacacggacagggatttttacatgagcgctaaagaagct
aaagagtatggcttgattgataaagtgttagagaaaaatgtgaagtga

DBGET integrated database retrieval system