KEGG   Helicobacter pylori Sat464: HPSAT_02825Help
Entry
HPSAT_02825       CDS       T01897                                 

Gene name
def
Definition
(GenBank) peptide deformylase
  KO
K01462  peptide deformylase [EC:3.5.1.88]
Organism
hpt  Helicobacter pylori Sat464
Brite
Enzymes [BR:hpt01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.88  peptide deformylase
     HPSAT_02825 (def)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pep_deformylase DUF2097
Motif
Other DBs
NCBI-ProteinID: ADO05310
Position
550479..551006
Genome map
AA seq 175 aa AA seqDB search
MALLEIIHYPSKILKTISKEVVSFDSKLHQQLDDMRESMIASEGIGLAAIQVGLPLRMLI
INLPREDGVQHKEDCLEIINPKFIETKGTIMYKEGCLSVPGFYEEVERFEKVKIEYQNRF
AEVKVLEASELLAVAIQHEIDHLNGVLFVDKLSILKRKKFEKELKELNKNPKNKS
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atggcgttattagagattatccattacccttctaaaattttaaaaacgatttctaaagag
gtcgtttcttttgattcaaaactccaccaacagctagatgacatgcgtgagagtatgatc
gctagtgaggggatagggttagccgctattcaagtgggtttgcctttaagaatgctcatt
atcaatctcccacgagaagatggcgtgcaacacaaagaagactgcttagaaatcattaac
cctaagtttatagaaactaaagggacgataatgtataaagaggggtgcttgtctgttccg
gggttttatgaagaagtggagcgctttgaaaaggttaagatagaataccaaaaccgcttc
gctgaagtgaaagttttagaagcgagcgagcttttagcggtagccatccagcatgaaata
gatcacctcaatggcgtgttattcgtggataaattgtctattttgaagcgtaagaaattt
gaaaaagaattaaaagaattaaataaaaatcccaaaaacaagtcctaa

DBGET integrated database retrieval system