KEGG   Helicobacter pylori Sat464: HPSAT_02880Help
Entry
HPSAT_02880       CDS       T01897                                 

Definition
(GenBank) hypothetical protein
Organism
hpt  Helicobacter pylori Sat464
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fib_alpha DUF4618 IncA SlyX
Motif
Other DBs
NCBI-ProteinID: ADO05321
Position
complement(566538..566804)
Genome map
AA seq 88 aa AA seqDB search
MKKIVVSWCVALAFLSADPVQANKAIINADLIKEIRDLKKIISAQNTEINNLKRVQEVLS
GQLGDMRKDILSTRDYCISLRPYIYNWR
NT seq 267 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaatcgttgtgagttggtgtgtggcgttggcttttttaagcgcggatccagtg
caagccaataaagcaatcattaatgcggatttgattaaagagataagggatttaaaaaaa
ataatcagcgcacaaaacactgagattaacaatttaaaaagagtgcaagaagtgttgtct
gggcaattaggggatatgcgtaaggatatattaagcactagagattattgcattagctta
agaccttatatctataattggcgctag

DBGET integrated database retrieval system