KEGG   Helicobacter pylori Sat464: HPSAT_02895Help
Entry
HPSAT_02895       CDS       T01897                                 

Gene name
pyrH
Definition
(GenBank) uridylate kinase
  KO
K09903  uridylate kinase [EC:2.7.4.22]
Organism
hpt  Helicobacter pylori Sat464
Pathway
hpt00240  Pyrimidine metabolism
hpt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hpt00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    HPSAT_02895 (pyrH)
Enzymes [BR:hpt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.22  UMP kinase
     HPSAT_02895 (pyrH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase
Motif
Other DBs
NCBI-ProteinID: ADO05324
Structure
PDB: 

Position
570362..571084
Genome map
AA seq 240 aa AA seqDB search
MQAKIKNKRVLVKFSGEALAGDNQFGIDIHVLDHIAKEIKSLVENAIEVGIVIGGGNIIR
GVSAAQGGIIRRTSGDYMGMLATVINAVAMQEALEHIGLDTRVQSAIEIKEICESYIYRK
AIRHLEKGRVVIFGAGTGNPFFTTDTAATLRAIEIGSDLIIKATKVDGIYDKDPNKFKNA
KKLDTLSYNDALIGDIEVMDDTAISLAKDNKLPIVVCNMFKKGNLLQVIKHQQGVFSMVK
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgcaagcaaaaataaaaaacaaacgggttttggtgaaattttctggggaagcgttagct
ggggacaaccagtttgggattgacattcatgtgttagatcacatcgctaaagaaattaaa
agcttagtggaaaacgctattgaagtgggtattgtgattggtggaggcaatatcattagg
ggggttagcgcggctcaaggggggattatcaggcgcaccagtggggattatatgggcatg
ttagccaccgtgattaatgcagtggccatgcaagaagctttagagcatatcggcttagac
acaagagtgcaaagcgcgattgaaatcaaagagatttgtgaaagttacatttacagaaaa
gcgatcaggcatttagaaaagggtagggtggtgatttttggcgctggcacgggaaacccg
tttttcactacggatacggctgccactttaagagcgattgaaattggatcggatttaatc
attaaagcgactaaagtggatggcatttacgacaaagaccctaacaagtttaaaaacgct
aaaaaattagacactttaagctataacgatgccttgataggggatattgaagtgatggac
gatactgctatttctttagctaaagacaataagctccccattgtggtgtgtaacatgttc
aaaaaagggaatttattgcaagtgatcaagcaccaacaaggcgtattttctatggtaaaa
taa

DBGET integrated database retrieval system