KEGG   Helicobacter pylori Sat464: HPSAT_02905Help
Entry
HPSAT_02905       CDS       T01897                                 

Definition
(GenBank) penta-phosphate guanosine-3'-pyrophosphohydrolase (spoT)
  KO
K01139  GTP diphosphokinase / guanosine-3',5'-bis(diphosphate) 3'-diphosphatase [EC:2.7.6.5 3.1.7.2]
Organism
hpt  Helicobacter pylori Sat464
Pathway
hpt00230  Purine metabolism
Brite
KEGG Orthology (KO) [BR:hpt00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    HPSAT_02905
Enzymes [BR:hpt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.5  GTP diphosphokinase
     HPSAT_02905
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.7  Diphosphoric-monoester hydrolases
    3.1.7.2  guanosine-3',5'-bis(diphosphate) 3'-diphosphatase
     HPSAT_02905
Ribosome biogenesis [BR:hpt03009]
 Prokaryotic Type
  Other maturation factors
   HPSAT_02905
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HD_4 RelA_SpoT TGS HD DUF1462
Motif
Other DBs
NCBI-ProteinID: ADO05326
Position
571338..573668
Genome map
AA seq 776 aa AA seqDB search
MNEIDKSVDIGFLRILDVIKKVTTPKGGIEILRTLIDFTPKIENALNLAAKSHKGQYRKS
GEPYIVHPICVASLVAFCGGDEAMVCAALLHDVVEDTPCKIETIEQEFGQDVANLVDALT
KITEIRKEELGVSSQDPRMVVSALTFRKILISAIQDPRALVVKISDRLHNMLTLDALPHD
KQVRISKETLAVYAPIASRLGMSSIKNELEDKSFYYIYPEEYKNIKEYLHKNKQSLLLKL
NAFASKLEKKLFDSGFSHSDFKLVTRVKRPYSIYLKMQRKGAVNIDEILDLLAIRILLKN
PIDCYKVLGIIHLNFKPIVSRFKDYIALPKENGYKTIHTTIFDESSVYEVQIRTFDMHMG
AEYGNSAHWKYKAGGVDNDDHHEGMRWLQNFKYHDSDLKNDPKEFYELAKNDLYREDIVV
FSPHGDTYTLPVGAIVLDFAYMVHSDLGDKATDAYVNSKKALLNQELRSGDVVKIVKGDK
VIPRFIWMDQLKTSKAKNHLRIQRRNRLKEIDTKSMINILATFFGRSVFEDVDLKDYKNF
EERLTDCGVETTLTEAMKSFENLAKLTEEIENKVFSLKEDAILEYQEMSLWTRGLRYLGF
KTSVLNFLTPNRQWQCKELEHFSVCSSNALEIKQVLLNDCCYPKYGDEIIAIVTDLKDPK
AIAHHKFCKKAMAEVDAKVPMVYIEWHKRDRTIYKMMFYLGEKKSVLASLLTFLNRNECN
IVGVSYLGYKDKYSSHCEVSFEIATDKADWIRALINRKYQDRIVELSSLDDAYELQ
NT seq 2331 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaaattgataaatccgttgatatcggattcttacggattcttgatgttattaaa
aaagttacgaccccaaagggcggcattgaaatcttaaggactttaattgatttcacgccc
aaaattgaaaacgccctaaatttagcggccaaaagccataaggggcagtatagaaaaagc
ggcgagccttatattgtccatcctatttgtgtggcaagcttggtagcgttttgtgggggc
gatgaggcgatggtgtgtgcagcgcttttgcatgatgtggtagaagacacgccctgtaaa
attgaaacgattgagcaagaatttgggcaagatgtggctaatttagtggatgcgctcact
aaaatcactgaaatcaggaaagaagagttaggagtgagctctcaagatcccagaatggtg
gtttcagcgctcacttttagaaagatcctaattagcgcgatacaagatccaagagcctta
gtggtaaagattagcgacaggttgcacaacatgctcaccttagacgccttgcctcatgac
aaacaagtgcgtatttctaaagaaactctagcggtgtatgcccccatagcgagccgattg
ggcatgtcttcaatcaaaaatgaattagaagataagagcttttattatatttatccagaa
gagtataaaaatatcaaggaatatttgcacaaaaacaagcagtctttactcttaaagctc
aacgcttttgcgagcaaattagaaaaaaaactttttgatagcgggtttagccattcggat
tttaaactcgttacaagggtgaaacgcccttattctatctatcttaagatgcaacgaaag
ggcgcggttaatattgatgaaattttggacttgttagccattaggattttattgaaaaac
ccgattgattgctataaagttttagggattatccatttgaatttcaaacccattgtttct
cgttttaaagattacatcgctttgcccaaagaaaatggctataagacgatacacacgacc
atttttgatgaatcttctgtttatgaagtgcagattcgcacctttgatatgcatatgggg
gcggagtatggtaattcagcccactggaagtataaagctgggggcgtggataatgacgat
catcatgagggcatgaggtggttgcaaaattttaaataccatgacagcgatttgaaaaac
gaccctaaggaattttacgaactcgctaagaacgatttgtatcgtgaagacattgtcgtt
ttttcgccccatggggacacttacaccttaccggtgggagcgattgttttagattttgct
tacatggtgcatagcgatttaggcgataaagccacggacgcttatgtcaatagtaaaaaa
gccttactcaatcaagaattaaggagtggggatgtggttaaaatcgttaaaggcgataaa
gtaatacctcgtttcatttggatggatcagcttaaaacttctaaggctaaaaaccatttg
cgcatccaaagaagaaaccgcttgaaagaaattgacactaagagcatgatcaatatctta
gcgactttttttgggcgctctgtttttgaagatgtggatttgaaagattataaaaacttt
gaagaaagattaacagattgtggggtggaaaccaccttaacagaagcgatgaaaagcttt
gaaaatttagccaaactcactgaagaaattgaaaataaggtgttttctttaaaagaagat
gcgattttggaataccaagagatgagtttatggactcgaggtttaaggtatttgggtttt
aaaaccagcgttttgaattttctaaccccaaaccggcagtggcagtgtaaggaattagaa
cattttagcgtttgttcaagcaacgctttagaaatcaaacaggtgttgttgaatgattgt
tgttaccctaaatatggcgatgaaatcattgcgattgtaacggatttaaaagatccaaaa
gcgattgcgcaccataaattttgcaaaaaagcgatggcggaagtggatgctaaagtgccg
atggtttatatagaatggcacaagcgggatcgaacgatttataaaatgatgttttattta
ggcgaaaaaaagtcggttttagcaagtttattgacttttttaaacaggaatgaatgcaat
attgtgggcgtgtcttacttaggctataaagacaagtattctagccattgtgaagtgagt
tttgaaatagctacggataaggcggattggatcagagccttaatcaatcgcaaatatcaa
gataggattgtagaattatccagtctggatgatgcttatgaattacaataa

DBGET integrated database retrieval system