KEGG   Helicobacter pylori Sat464: HPSAT_02930Help
Entry
HPSAT_02930       CDS       T01897                                 

Gene name
flhB
Definition
(GenBank) flagellar biosynthesis protein FlhB
  KO
K02401  flagellar biosynthetic protein FlhB
Organism
hpt  Helicobacter pylori Sat464
Pathway
hpt02040  Flagellar assembly
Brite
KEGG Orthology (KO) [BR:hpt00001]
 09140 Cellular Processes
  09142 Cell motility
   02040 Flagellar assembly
    HPSAT_02930 (flhB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:hpt02044]
    HPSAT_02930 (flhB)
   02035 Bacterial motility proteins [BR:hpt02035]
    HPSAT_02930 (flhB)
Secretion system [BR:hpt02044]
 Type III secretion system
  Flagellar export apparatus
   HPSAT_02930 (flhB)
Bacterial motility proteins [BR:hpt02035]
 Flagellar system
  Flagellar assembly proteins
   Type-III secretion
    HPSAT_02930 (flhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Bac_export_2 DUF2254
Motif
Other DBs
NCBI-ProteinID: ADO05331
Position
complement(578170..579246)
Genome map
AA seq 358 aa AA seqDB search
MAEEEKTELPSAKKIQKAREEGNVPKSMEVVGFLGLLAGLLSIFVFFIWWVDGFSEMYRH
AVKDFSLDFSKESVQKLFNQLAKDTFLLLLPVLIILVVVAFLSNVLQFGWLFAPKVIEPK
FSKINPINGTKNLFSLKKLLDGSLITLKVFLAFFLGFFIFSLFLGELNHAALLNLQGQLL
WFKSKALLLISSLLFLFFILAFIDLAIKRRQYTNSLKMTKQEVKDEYKQQEGNPEIKAKI
RQMMIKNATNKMMQEIPKANVVVTNPTHYAVALKFDEEHPVPVVVAKGMDYLAIRIKGIA
REHDIEIIENKTLARELYRDVKLNATIPEELFEAVAIVFAQVAKLEQERQKQKIIKPL
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atggctgaagaagaaaaaaccgaactccctagcgcgaaaaaaatccaaaaagccagagaa
gaaggcaatgtgcctaagagcatggaagtggtggggtttttagggttattagctggatta
ctcagtatttttgttttttttatatggtgggtggatggctttagcgagatgtatcgccat
gcagtgaaagatttttccctagattttagtaaagaaagcgttcaaaagctgtttaaccaa
ctggctaaagacacttttttattgcttttacctgttttaatcattttagtggtggtggcg
tttttatctaatgtcttgcaatttggctggctctttgcccctaaagtcattgagcctaaa
ttttctaaaatcaaccctatcaatggcaccaaaaaccttttttctttaaaaaagctcctt
gatgggagtttgatcaccttaaaagtttttttagctttttttctggggtttttcatcttt
tccttatttttaggggaattaaaccatgcggctcttttgaatttgcaaggccagttattg
tggtttaaaagcaaggcgttactgctcatttcttcgcttttatttttattttttatcttg
gcttttatagacttagcaatcaaacgccgccaatacaccaactctttaaaaatgactaag
caagaagttaaggacgaatacaaacagcaagaaggaaacccagaaatcaaagccaaaatc
cgccaaatgatgataaaaaacgccacgaataaaatgatgcaagaaatccctaaagctaat
gtcgtggttactaaccctacccattatgccgtcgctctcaaatttgatgaagaacaccct
gtgccggtggtggtggctaaaggcatggattatttagccattaggattaagggtatcgct
agagagcatgacatagaaattatagaaaacaaaacgctcgctagagagctttatagagat
gtgaaattaaacgctaccataccagaagaattgtttgaagccgtggcgatagtctttgct
caagtggctaaattagagcaagaacgccagaaacaaaagatcattaaacctctttaa

DBGET integrated database retrieval system