KEGG   Helicobacter pylori Sat464: HPSAT_02935Help
Entry
HPSAT_02935       CDS       T01897                                 

Definition
(GenBank) molybdopterin-guanine dinucleotide biosynthesis protein A
  KO
K03752  molybdenum cofactor guanylyltransferase [EC:2.7.7.77]
Organism
hpt  Helicobacter pylori Sat464
Pathway
hpt00790  Folate biosynthesis
hpt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hpt00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    HPSAT_02935
Enzymes [BR:hpt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.77  molybdenum cofactor guanylyltransferase
     HPSAT_02935
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transf_3 DUF5001
Motif
Other DBs
NCBI-ProteinID: ADO05332
Position
complement(579239..579844)
Genome map
AA seq 201 aa AA seqDB search
MKNPIIDNIPCVLLAGGKSSRFIINNIQINKALMPFESYFSLLEYQYTRLLKLFKKVIIS
AKKSYELNAPYLLERESDLFSPLFGIHNAFLTLQTPYIFFIPIDTPLVSFESIKALCGIK
NFSVIYAKSPTKEHYLISLWHQSSLNALNYALKTQNYRLSDLVKNTSSIAMHLDKEEEFL
NLNTLKDYELAVQILKERANG
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaaaccctatcattgataacattccttgcgttttactggctgggggcaaaagctct
cgttttatcattaataacattcaaatcaataaggctctcatgccttttgaatcgtatttt
agccttttagaataccaatacacgcgccttttaaaacttttcaaaaaagtcattatcagc
gctaaaaaatcgtatgaactaaacgctccctatcttttagaaagagagagcgatcttttt
tcacccctttttggcattcataacgcttttttaacattgcaaaccccttatatttttttt
atccctatagatacgcctttagtgtcctttgaaagcattaaggctctttgtgggattaaa
aactttagcgtaatctatgctaaaagtcctacaaaagaacattatttgatttctttgtgg
catcaaagtagccttaacgcccttaattacgctcttaaaacacaaaattatcgccttagt
gatcttgtgaaaaatacctcttctatcgctatgcatttggataaagaagaagaattttta
aacctaaacaccctaaaagactatgaattagccgttcaaattttaaaagagagagccaat
ggctga

DBGET integrated database retrieval system