KEGG   Helicobacter pylori Sat464: HPSAT_02940Help
Entry
HPSAT_02940       CDS       T01897                                 

Gene name
moaA
Definition
(GenBank) molybdenum cofactor biosynthesis protein A
  KO
K03639  GTP 3',8-cyclase [EC:4.1.99.22]
Organism
hpt  Helicobacter pylori Sat464
Pathway
hpt00790  Folate biosynthesis
hpt01100  Metabolic pathways
hpt04122  Sulfur relay system
Brite
KEGG Orthology (KO) [BR:hpt00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    HPSAT_02940 (moaA)
 Genetic Information Processing
  Folding, sorting and degradation
   04122 Sulfur relay system
    HPSAT_02940 (moaA)
Enzymes [BR:hpt01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.99  Other carbon-carbon lyases
    4.1.99.22  GTP 3',8-cyclase
     HPSAT_02940 (moaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mob_synth_C Radical_SAM Fer4_12 Fer4_14 CppA_N Glyco_hydro_97
Motif
Other DBs
NCBI-ProteinID: ADO05333
Position
579930..580895
Genome map
AA seq 321 aa AA seqDB search
MLVDNFNRVIDYIRVSVTKQCNFRCQYCMPTTPLNFFDGEELLPLDNVLEFLKIAIDEGV
KKIRITGGEPLLRKGLDEFIAKLHAYNKEVALVLSTNGFLLKKMAKDLKNAGLSRVNVSL
DSLKSDRVLKISQKDALKNTLEGIEESLEVGLKLKLNMVVMKSVNDDEILELLEYAKNRH
IQIRYIEFMENTHAKSLVKGLKEREILDLIAQKYQIIATEKPKQGSSKIYTLENGYQFGI
IAPHSDDFCQSCNRIRLASDGKICPCLYYQDAIDAKEAIMNKDTKNIKRLLKQSIINKPE
KNMWNDKNSETPTRAFYYTGG
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
gtgttagtagataattttaatagggttattgactatattagggtttctgtaaccaaacaa
tgtaatttcaggtgtcagtattgcatgcctactacgccattaaatttttttgatggtgaa
gaattattgcctttggataatgttttagaatttcttaaaatcgccattgatgaaggcgtt
aaaaaaattagaatcaccggtggggagcctctattacgcaagggtttagatgaatttatc
gctaaactacacgcttacaataaagaagtggcgttagttttaagcactaatggtttttta
ctcaaaaaaatggctaaggatttaaaaaatgccgggttatcccgagtgaatgtttcattg
gattctttaaaaagcgatagggttttaaaaatctctcaaaaagacgctcttaaaaatacg
ctagaagggattgaagagtccttggaagtgggtttaaaactcaaattaaacatggttgtg
atgaaaagcgttaatgatgatgaaatcttagagcttttagaatacgcaaaaaataggcat
atccaaatccgctacattgaatttatggaaaacacgcatgctaaaagtttggttaaaggc
ttgaaagagcgagaaattttagatttgatcgctcaaaaatatcaaatcattgcgacagaa
aaacctaaacaagggtcttctaaaatctacacgctagaaaatggctatcaatttggcatt
atcgctccgcatagcgatgatttttgccaatcttgcaatcgtatccgtttggcttctgat
ggtaagatttgtccatgcttatactatcaagacgccatagacgctaaggaggcgatcatg
aataaggatacaaaaaatataaaaaggcttttaaagcaatctatcatcaataaaccagaa
aaaaacatgtggaatgataaaaacagcgaaactcccacaagggcgttttactatacaggg
gggtag

DBGET integrated database retrieval system