KEGG   Helicobacter pylori Sat464: HPSAT_02960Help
Entry
HPSAT_02960       CDS       T01897                                 

Definition
(GenBank) hypothetical protein
Organism
hpt  Helicobacter pylori Sat464
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Katanin_con80 DUF3040
Motif
Other DBs
NCBI-ProteinID: ADO05335
Position
581916..582662
Genome map
AA seq 248 aa AA seqDB search
MNAIGVGALVSGGVSLITNIYECVTKGKDPKEALKRATTETLKGGVHSHGIAFGGSLLGG
VMQNNANQVIQNLSNGSMPTMVVGVGVKSCRILTKYFRGEINSVELFGGFVGVALSEAFF
NALNSKKVELARQKRIEIEKKCREHIRQLEMYQNQFKEVFERYFQETARFFNESFDELER
ALYAGDADLAIEANNKIQEGLGQKPFLGGLAIAAAGYGVKKGIDACNAARKANKFIKKAE
SLKKKAIK
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgaacgctataggagtcggtgcgctggtgagtggtggggtttcattgataacgaatatt
tatgaatgcgttaccaagggaaaagaccccaaagaagcgctcaagcgtgccaccactgag
actctaaagggtggggtgcatagtcatggtattgcatttgggggttcattgttggggggc
gtgatgcaaaataacgctaaccaagtcatccaaaaccttagcaatggttcaatgcctacg
atggttgtaggggttggtgtgaaaagttgtagaattttaactaaatattttcgtggagag
attaatagtgtggagctttttgggggctttgtgggtgtagcgttgagcgaagcttttttt
aacgccttaaattctaaaaaggttgaactagcacgccaaaagcgtattgagattgagaaa
aaatgccgtgagcatatcaggcagctagagatgtatcaaaatcaatttaaggaggtgttt
gagcggtattttcaagagactgcgagattctttaatgagagttttgatgagttggagaga
gcgctttatgcgggcgatgcggatttagccatagaagccaataacaagatccaagaaggg
ctaggtcaaaagccgtttttaggagggttagccatagcggctgcaggatatggagtcaaa
aaagggattgatgcgtgcaatgccgctcgcaaagctaataaatttatcaaaaaggcagag
agtttaaaaaagaaagcaattaaatag

DBGET integrated database retrieval system