KEGG   Helicobacter pylori Sat464: HPSAT_02985Help
Entry
HPSAT_02985       CDS       T01897                                 

Definition
(GenBank) hypothetical protein
Organism
hpt  Helicobacter pylori Sat464
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 5-FTHF_cyc-lig
Motif
Other DBs
NCBI-ProteinID: ADO05340
Position
585714..586361
Genome map
AA seq 215 aa AA seqDB search
MKRAKPTKDKAVRDKLACKLLFWKLKDYQNILLYSPLGHELDIRPLILKLRQKNKRVWLP
KSIKKGANFSKEGFTIAPFRLPLRRLGWFDEPSLSRYYKQKLDCIVVPILGMDTSFRRVG
FGLGMYDRSLPQLFRRRLKRPLIVFVSRELALANGVLTDAYDIEADLYMNARIVMKNNRR
KHYEQRVNLHFIRSLSSVFDYRSSHVLCDEKDLLC
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaagggctaaaccaaccaaagataaagcggtcagggataaactggcttgcaagctt
ttattttggaaactcaaagattatcaaaatattttattgtatagcccattagggcatgag
cttgacattaggcctttgattttgaagttaagacaaaaaaataagcgcgtgtggttgcct
aaaagcatcaaaaaaggcgctaatttttctaaagagggtttcactatcgcgccctttagg
ttgcccttaaggcgtttggggtggtttgatgagccgagtttgtcgcgttattataagcag
aaattggattgtattgtcgtgccgattttagggatggatacaagctttaggcgcgtgggt
tttgggctaggcatgtatgataggagtttgccccaattattcagaaggcggctaaaacgc
cccttaatcgtgtttgtgagtagggaattagctctagctaatggtgttcttacagacgct
tatgacattgaagcggatctttatatgaatgctcgtatcgttatgaagaataatagaagg
aaacattatgagcagcgggttaatttacatttcattagaagtcttagtagcgtgtttgat
taccgctctagtcatgtattatgtgatgaaaaagatctattatgctag

DBGET integrated database retrieval system