KEGG   Helicobacter pylori Sat464: HPSAT_03015Help
Entry
HPSAT_03015       CDS       T01897                                 

Definition
(GenBank) molybdopterin biosynthesis protein
Organism
hpt  Helicobacter pylori Sat464
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ThiF Shikimate_DH NAD_binding_7 TrkA_N
Motif
Other DBs
NCBI-ProteinID: ADO05346
Position
complement(591664..592323)
Genome map
AA seq 219 aa AA seqDB search
MSEPIDRFTRIRWLFKNDFEKIRRQRVLICGVGGVGGFALDALYRVGIGQITIIDKDAFD
VTNQNRQIGSERIGESKVLVLQDLYKGIQALNLHIDEAFLNSFNFRDYDYILDCMDDLPI
KTSLAIKCQNFAYGKFISSMGSAKRLNPKHIQVGSVWESYGDKFGRKFRDFLKKRRFKGD
FKVVFSPEVPHCIELGSFNAVTASFGLQIASEVVQDIIK
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
ttgtctgaacccatagatagattcacgcgcataaggtggttgtttaaaaacgattttgaa
aaaatccgccgacaaagggttttaatctgtggcgtggggggcgttggaggctttgcgcta
gacgctttgtatcgtgtggggatagggcaaatcactatcattgataaagatgcgtttgat
gttaccaatcaaaaccgccagattggatcagaaaggataggagaatctaaagtgttggtg
ttgcaagatctctataagggcattcaggctttgaatttgcacatagatgaagcgttttta
aattcgtttaattttagagattatgattacattttagattgcatggacgatttgcctatt
aaaacgagcttagcgatcaaatgtcaaaatttcgcttacgggaaatttatcagctctatg
gggagtgcaaaacgcttgaaccctaaacacatccaagtggggagcgtgtgggaaagctat
ggcgataaattcgggcgtaaatttagggattttttaaaaaaacgccgttttaaaggggat
tttaaagtggtttttagccctgaagtcccgcattgcatagagcttgggagttttaatgcg
gttacggcgagttttggtttgcaaatagcgagtgaagtcgtgcaagacattatcaaataa

DBGET integrated database retrieval system