KEGG   Helicobacter pylori Sat464: HPSAT_03045Help
Entry
HPSAT_03045       CDS       T01897                                 

Definition
(GenBank) cell division membrane protein (ftsX)
  KO
K09811  cell division transport system permease protein
Organism
hpt  Helicobacter pylori Sat464
Pathway
hpt02010  ABC transporters
Module
hpt_M00256  Cell division transport system
Brite
KEGG Orthology (KO) [BR:hpt00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    HPSAT_03045
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hpt03036]
    HPSAT_03045
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hpt02000]
    HPSAT_03045
Chromosome and associated proteins [BR:hpt03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Divisome proteins
    HPSAT_03045
Transporters [BR:hpt02000]
 ABC Transporters, Prokaryotic Type
  ABC-2 type and other transporters
   Cell division transporter [MD:M00256] [OT]
    HPSAT_03045
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1752
Motif
Other DBs
NCBI-ProteinID: ADO05352
Position
complement(596763..597569)
Genome map
AA seq 268 aa AA seqDB search
MNTLKKHLAFIIPLVALLFSLECVLFINQAIEQKEKKLIEDYSVVLASTQKLGLELLRQN
FSEIVALKEIDPNYSLEPLQKTLGMDGLKELRKNLPFFYSLQLSTFPTQERLENIKEKLL
KIPGVQKVEVFAKTYMQVYDLLSFIKAAVYIFALVVFVLSVLLMFKQVRIWIYQYHERLE
IMDLLGASVSFKNGFLYKIALMDSIIASFLAPMFMLYITSQKGFEKTMDTLGIIGGAFAL
NHFLWGLLFSLVVSFVSVLLVAWRTRHV
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgaatactcttaaaaagcatttagcctttatcattcccctagtagcgttattgtttagt
ttggagtgcgtgttatttatcaatcaagcgatagagcaaaaagaaaaaaaattgattgaa
gattattcggtcgtgttggccagcacgcaaaaattaggcttggaattgttgcgtcaaaat
tttagcgaaatcgtagcgttaaaagaaattgatcctaattactctttagagcctcttcaa
aaaactttaggcatggacgggcttaaggaattaagaaaaaatttaccctttttttattct
ttacaactttccacattccccactcaagagcgtttagaaaacattaaagaaaaattgctc
aaaatccctggcgttcaaaaagttgaagtctttgccaaaacttacatgcaagtgtatgat
ctcttgagttttattaaagcagcggtctatatctttgcgttagtggtctttgtcttatcg
gttttattgatgtttaaacaagtccgcatctggatctatcaataccatgagaggctagag
attatggatttattaggggcttcggtgtcttttaaaaacgggtttttgtataaaatagct
ttaatggattccataatcgctagttttttagcccccatgttcatgctctatatcacttcg
caaaaaggttttgaaaaaacgatggatactttgggtattataggaggcgcgtttgcttta
aaccattttttatggggactgctttttagccttgtggtttcatttgtttctgttttactt
gtagcttggagaactagacatgtataa

DBGET integrated database retrieval system