KEGG   Helicobacter pylori Sat464: HPSAT_03050Help
Entry
HPSAT_03050       CDS       T01897                                 

Definition
(GenBank) cell division protein
  KO
K09812  cell division transport system ATP-binding protein
Organism
hpt  Helicobacter pylori Sat464
Pathway
hpt02010  ABC transporters
Module
hpt_M00256  Cell division transport system
Brite
KEGG Orthology (KO) [BR:hpt00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    HPSAT_03050
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hpt03036]
    HPSAT_03050
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hpt02000]
    HPSAT_03050
Chromosome and associated proteins [BR:hpt03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Divisome proteins
    HPSAT_03050
Transporters [BR:hpt02000]
 ABC Transporters, Prokaryotic Type
  ABC-2 type and other transporters
   Cell division transporter [MD:M00256] [OT]
    HPSAT_03050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran SMC_N AAA_29 AAA_22 AAA_16 AAA_21 ATPase_2 RsgA_GTPase T2SSE NB-ARC AAA NACHT AAA_23 RNA_helicase AAA_14 AAA_33 Zeta_toxin ATP_bind_1 AAA_18 NTPase_1 AAA_13 AAA_25 RNA12 AAA_32 AAA_30
Motif
Other DBs
NCBI-ProteinID: ADO05353
Position
complement(597556..598227)
Genome map
AA seq 223 aa AA seqDB search
MSVIIAANNLCLQYQQNEPVIKHANLRIKRKDFVFISGPSGSGKSTLLRSFYGDLKLFSG
KLEVCNINMNNASKATILDLRKNIGVVFQDYKLIQDYTIEQNIKLPMVICGVKKEECRLQ
LEKLLGHIDLRHKANRYPKELSGGEQQRVAMARAMANCPELILADEPTGNLDDYSSDKIW
SLLRGMNTQLNATIVVVTHKFPKNFSAYHRKFYIEDGEVYEYS
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgagtgtgatcatcgcagcgaacaatctgtgcttacaataccagcaaaacgaaccggtc
attaagcatgctaatttacgcatcaaacgcaaggattttgtgttcatttcagggcctagc
gggagcggtaaaagcacgcttttgcgttcgttctatggggatttaaaactttttagcggc
aaattagaagtttgcaatatcaacatgaacaacgcttcaaaagcgacgattttagatttg
cgtaaaaatatcggcgtggttttccaagattataaattgatccaagattacacgattgag
caaaacatcaaactaccgatggtgatttgtggcgttaaaaaagaagaatgccgcttgcag
ctagaaaaacttttagggcatattgatttacgccataaggctaaccgctaccccaaagag
ctcagcggaggcgaacaacagcgagtggctatggctagagctatggcgaactgccctgaa
ctcattttagccgatgagcctactgggaatttagacgattattctagcgataaaatctgg
agcttgttaaggggcatgaacacgcaattaaacgctacgatcgtggtggttacgcacaaa
ttccctaaaaattttagcgcttatcaccgaaaattttatatagaagatggggaagtttat
gaatactcttaa

DBGET integrated database retrieval system