KEGG   Helicobacter pylori Sat464: HPSAT_03355Help
Entry
HPSAT_03355       CDS       T01897                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
hpt  Helicobacter pylori Sat464
Pathway
hpt00071  Fatty acid degradation
hpt00072  Synthesis and degradation of ketone bodies
hpt00280  Valine, leucine and isoleucine degradation
hpt00310  Lysine degradation
hpt00362  Benzoate degradation
hpt00380  Tryptophan metabolism
hpt00620  Pyruvate metabolism
hpt00630  Glyoxylate and dicarboxylate metabolism
hpt00640  Propanoate metabolism
hpt00650  Butanoate metabolism
hpt00900  Terpenoid backbone biosynthesis
hpt01100  Metabolic pathways
hpt01110  Biosynthesis of secondary metabolites
hpt01120  Microbial metabolism in diverse environments
hpt01130  Biosynthesis of antibiotics
hpt01200  Carbon metabolism
hpt01212  Fatty acid metabolism
hpt02020  Two-component system
Brite
KEGG Orthology (KO) [BR:hpt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    HPSAT_03355
   00630 Glyoxylate and dicarboxylate metabolism
    HPSAT_03355
   00640 Propanoate metabolism
    HPSAT_03355
   00650 Butanoate metabolism
    HPSAT_03355
  09103 Lipid metabolism
   00071 Fatty acid degradation
    HPSAT_03355
   00072 Synthesis and degradation of ketone bodies
    HPSAT_03355
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    HPSAT_03355
   00310 Lysine degradation
    HPSAT_03355
   00380 Tryptophan metabolism
    HPSAT_03355
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    HPSAT_03355
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    HPSAT_03355
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    HPSAT_03355
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hpt04147]
    HPSAT_03355
Enzymes [BR:hpt01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     HPSAT_03355
Exosome [BR:hpt04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   HPSAT_03355
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ADO05409
Position
complement(656168..657343)
Genome map
AA seq 391 aa AA seqDB search
MNEVVVVAAKRSAIGSFLGSLKSVGAREMGTVVLKDALKASGLKPSDVDSVILGNVLSAG
LGQNIARQIQLDAGIPNDRNAFSVNMVCGSSMKAIQLAHDSIMLGRDEVVVCGGVENMSM
APYLSFDMRDGKRMGNANMIDSMIHDGLWDAFNDYHMGITADNVAQAYHISREEQDAFAL
QSQLKARAAINAGKFQEEITPIEIANKKGVVVFKEDEYPRETTLESLAKLKPAFKKDGSV
TAGNSSGINDGASIIILCSAQKAQKLGLKTMATIKGFGLGGCSPDIMGICPSIAIKNNLK
NVKMNLNDIDLFELNEAFAAQSIAVLKELELNPNIVNVNGGAIAIGHPIGASGARILVTL
LHEMKRSGHGVGCASLCVGGGQGLSVVVEQK
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaagtggttgtagtggcggcaaaacgaagcgctatagggagttttttaggctct
ctaaagagcgtgggtgctagagaaatgggtactgtcgtgcttaaagacgctttgaaggcg
agcggtcttaagcctagcgatgtggattctgtcattttaggcaatgttttatccgccggt
ttgggtcaaaatatcgccagacagatccaactggacgctggcatccctaatgacaggaac
gcttttagcgtcaatatggtttgtggatcgtctatgaaagccattcaattagcgcatgac
agcatcatgcttgggcgcgatgaggtggtggtgtgcggtggcgtggaaaacatgagcatg
gcaccctatctgtcgtttgacatgcgagacgggaaaagaatggggaatgcgaacatgata
gactccatgattcatgacggattgtgggatgcgttcaatgattaccacatggggatcacc
gctgataatgtcgctcaagcataccacatcagccgagaagagcaagatgctttcgcgctc
caatcgcaactcaaagcaagagccgccattaatgcagggaaattccaagaagaaatcacg
cctattgaaatagcgaataaaaaaggcgtggttgtttttaaagaagacgaataccctaga
gaaacgacgctagaatcccttgcaaagctcaaacccgctttcaaaaaagacggatcggta
acggcaggaaattcatcagggatcaatgatggcgcgagtattatcattttatgcagcgct
caaaaagcgcaaaaattggggttaaaaacaatggcaactatcaaggggtttggtttgggt
ggttgcagtccggatataatggggatatgccctagcatcgctattaaaaacaaccttaaa
aatgtcaaaatgaatctcaacgacatcgatctttttgaactcaatgaagccttcgccgcg
caaagcatagccgtgttaaaagagcttgaattaaaccccaatatcgtgaatgtgaatgga
ggtgcgatagccattggccaccctattggcgcaagcggtgctaggatcttggtaacttta
ttgcatgaaatgaaaagaagcggtcatggcgtgggctgcgcgtcattgtgtgtgggcggc
ggacaaggtctatcagtggtagtggaacaaaaataa

DBGET integrated database retrieval system