KEGG   Helicobacter pylori Sat464: HPSAT_05270Help
Entry
HPSAT_05270       CDS       T01897                                 

Gene name
glk
Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
hpt  Helicobacter pylori Sat464
Pathway
hpt00010  Glycolysis / Gluconeogenesis
hpt00052  Galactose metabolism
hpt00500  Starch and sucrose metabolism
hpt00520  Amino sugar and nucleotide sugar metabolism
hpt00521  Streptomycin biosynthesis
hpt01100  Metabolic pathways
hpt01110  Biosynthesis of secondary metabolites
hpt01120  Microbial metabolism in diverse environments
hpt01130  Biosynthesis of antibiotics
hpt01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hpt00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HPSAT_05270 (glk)
   00052 Galactose metabolism
    HPSAT_05270 (glk)
   00500 Starch and sucrose metabolism
    HPSAT_05270 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    HPSAT_05270 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    HPSAT_05270 (glk)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    HPSAT_05270 (glk)
Enzymes [BR:hpt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     HPSAT_05270 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase
Motif
Other DBs
NCBI-ProteinID: ADO05772
Position
1069097..1070107
Genome map
AA seq 336 aa AA seqDB search
MPKTETYPRLLADIGGTNARFGLEVAPRQIECIEVLPCKDFESLSDAVRFYLSKCKESLK
LHPIYGSFAVATPIMGDFVQMTNNHWTFSIETTRQCLDLKKLLVINDFVAQAYAISAMQE
NDLAQIGGIKCEINAPKAILGPGTGLGVSTLIQNSDGSLKVLPGEGGHVSFAPFDDLEIL
VWQYARSKFNHVSAERFLSGSGLVLIYEALSKRKGLEKVAKLSKAELTPQIISERALNGD
YPICRLTLDTFCSMLGTLAADVALTLGARGGVYLCGGIIPRFIDYFKTSPFRARFETKGR
MGAFLASIPVHVVLKKTPGLDGAGIALENYLLHDKI
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaaactgaaacttacccaagactattagccgatattggcggcacgaacgcgcgc
tttggcttagaagtcgccccacgacagattgaatgcattgaagtcttgccatgcaaagat
tttgaaagcttgagcgatgcggtgcgattctatctttctaaatgcaaagaaagccttaaa
ctgcaccctatttatggctcttttgctgtggctacgcccattatgggggattttgtccaa
atgactaacaaccattggactttttctattgaaacgacacggcaatgtttggatttaaaa
aaattgcttgtcatcaacgattttgtcgcgcaagcctatgccattagcgcgatgcaagaa
aacgatctggctcaaataggcgggattaaatgcgagatcaacgctcctaaagcgatttta
gggccaggaactgggcttggggtaagcactcttatccaaaacagcgatggctctttaaaa
gtcttgcccggtgaaggggggcatgtgagcttcgccccttttgatgatttagaaatttta
gtgtggcaatacgcccgctctaaattcaatcatgtgagcgcggaaaggtttttgagcggg
agcggtttggtgctgatttatgaggccctgtctaagcgcaaaggcttagaaaaagtggcg
aagttaagcaaggctgaattaaccccacaaatcattagcgaacgcgctttgaatggggat
taccctatatgccgattgactttggatactttttgctccatgctaggcacgctcgctgct
gatgtggctctcactttgggggctagagggggcgtgtatttgtgtggggggattatcccg
cgattcattgattattttaaaacttcgccctttagagcgcgttttgaaacgaaagggcgc
atgggagcgtttctcgcttctatccctgtgcatgtcgtgctgaaaaaaactccgggactt
gatggggcaggcattgcgttagagaattatttactgcatgataagatatag

DBGET integrated database retrieval system