KEGG   Helicobacter pylori Sat464: HPSAT_05310Help
Entry
HPSAT_05310       CDS       T01897                                 

Gene name
porD
Definition
(GenBank) pyruvate flavodoxin oxidoreductase subunit delta
  KO
K00171  pyruvate ferredoxin oxidoreductase delta subunit [EC:1.2.7.1]
Organism
hpt  Helicobacter pylori Sat464
Pathway
hpt00010  Glycolysis / Gluconeogenesis
hpt00020  Citrate cycle (TCA cycle)
hpt00620  Pyruvate metabolism
hpt00640  Propanoate metabolism
hpt00650  Butanoate metabolism
hpt00680  Methane metabolism
hpt01100  Metabolic pathways
hpt01120  Microbial metabolism in diverse environments
hpt01130  Biosynthesis of antibiotics
hpt01200  Carbon metabolism
Module
hpt_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:hpt00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HPSAT_05310 (porD)
   00020 Citrate cycle (TCA cycle)
    HPSAT_05310 (porD)
   00620 Pyruvate metabolism
    HPSAT_05310 (porD)
   00640 Propanoate metabolism
    HPSAT_05310 (porD)
   00650 Butanoate metabolism
    HPSAT_05310 (porD)
  Energy metabolism
   00680 Methane metabolism
    HPSAT_05310 (porD)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    HPSAT_05310 (porD)
Enzymes [BR:hpt01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     HPSAT_05310 (porD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4 Fer4_21 Fer4_6 Fer4_10 Fer4_2 Fer4_9 Fer4_17 Fer4_15 Fer4_7 Fer4_16 Fer4_8 Fer4_4 Fer4_13 Fer4_18 Fer4_22 Fer4_3
Motif
Other DBs
NCBI-ProteinID: ADO05780
Position
1076851..1077243
Genome map
AA seq 130 aa AA seqDB search
MKDWNEFEMGAVLFPFEKNAQSEMEKHNDERHYTEQSYFTTSVAHWRVAKPVHNNNICIN
CFNCWVYCPDAAILSREGKLKGVDYSHCKGCGVCVDVCPTNPKSLWMFEEQIELASALTQ
WPQKQEKKKS
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atgaaagattggaatgaatttgaaatgggagcggtgctcttcccttttgaaaaaaacgcg
caaagcgaaatggaaaaacacaatgatgagcgccattacaccgagcaaagctatttcacc
acttcagtggctcattggcgcgtggctaagcctgtgcataacaataacatttgcatcaac
tgctttaattgttgggtttattgcccagatgctgctattctttcaagagagggcaagtta
aaaggcgtggattattctcattgtaaaggctgtggcgtgtgtgtggatgtctgccccacc
aaccctaaatcgctatggatgtttgaagaacaaattgagcttgctagtgctctcactcaa
tggccgcaaaaacaagaaaagaaaaaatcgtaa

DBGET integrated database retrieval system