KEGG   Helicobacter pylori Cuz20: HPCU_00265Help
Entry
HPCU_00265        CDS       T01894                                 

Definition
(GenBank) Proline/pyrroline-5-carboxylate dehydrogenase
  KO
K13821  RHH-type transcriptional regulator, proline utilization regulon repressor / proline dehydrogenase / delta 1-pyrroline-5-carboxylate dehydrogenase [EC:1.5.5.2 1.2.1.88]
Organism
hpu  Helicobacter pylori Cuz20
Pathway
hpu00250  Alanine, aspartate and glutamate metabolism
hpu00330  Arginine and proline metabolism
hpu01100  Metabolic pathways
hpu01110  Biosynthesis of secondary metabolites
hpu01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:hpu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    HPCU_00265
   00330 Arginine and proline metabolism
    HPCU_00265
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hpu03000]
    HPCU_00265
Enzymes [BR:hpu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.88  L-glutamate gamma-semialdehyde dehydrogenase
     HPCU_00265
  1.5  Acting on the CH-NH group of donors
   1.5.5  With a quinone or similar compound as acceptor
    1.5.5.2  proline dehydrogenase
     HPCU_00265
Transcription factors [BR:hpu03000]
 Prokaryotic Type
  Ribbon-helix-helix
   Other families
    HPCU_00265
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh Pro_dh
Motif
Other DBs
NCBI-ProteinID: ADO03246
Position
complement(51946..55503)
Genome map
AA seq 1185 aa AA seqDB search
MQKIIDDSLELAKKLQDSISNHLSEQEKAFHSKMQKLLNNPENKVMLIELMDRSFRCLDN
KARFEMIEHVLDKYKSREIFSPFEKLLLMGFLSFGKMLPDMSVPFFVNKIRSDTKAMVLD
QEESQLKERILKRKNEKIILNVNFIGEEVLGEEEANARFEKYSQALKSNYIQYISIKITT
IFSQINILDFEYSKKEIVKRLDALYALALEEEKKQGMPKFINLDMEEFRDLELTVESFME
SIAKFDLNAGIVLQAYIPDSYEYLKKLHAFSKERVLKGLKPIKIRFVKGANMESEETIAS
VKDWALPTFSNKQDTDSNYNKMLDFVLEGDNYKYIHIGAASHNIFEIAYVYTRIHALNDP
VVLEHFSFEMLEGMSLQASQELKEMHKLILYAPVCDEAHFNNAIAYLVRRLDENTSSDNF
MKAFFNLKVGTSEWEDQEQRFLNSLKGIATLDNATHRTQDRNAKQSGHTTYPNHSFKNES
DTDFILKANREWAKKVREKMHNAPILELYPEMDGRFEDPNLTPLEVFDKIHHKKIASVHL
ADKEAILKALEVAKSDKSRFSQKSFTEIHALMSQTAQLFRERRGDLIGISALEVGKTFAE
TDAEVSEAIDFLEFYPYSLRVLQEQNKKTKFTPKGVGVVIAPWNFPVGISVGTIAAPLAA
GNRVIYKPSSLSSVTGYKLCECFWDAGVPRDALIYLPSKGSDISEHLLKDESIKFAILTG
GEDTAYKMLEANPTLALSAETGGKNATIVSKMADRDQAIKNVIHSAFSNSGQKCSATSLL
VLEKEVYEDENFKKTLIDATLSLSVGDPFDFKNKIGTLADKPNEKVIKAIDELKSYENYE
IPVSFVNDNPYLMKPSIKYGTKKGDFTHQTELFTPILSVMKAQDLDEAIDIVNSTGYGLT
SALESLDEREWEYYLKRIEAGNIYINKPTTGAIVLRQPFGGVKKSAVGFGRKVGIFNYIT
QFVNIHQEEEDENALKNPLSEALEGLTQKGYDEHTHELRRAIFMAKSYAYHYKHEFSQAK
DYVKIRGEDNLFSYTKVKSVGYRITEKDTLSDMLGVALACLISQIPLTLSIENERANKDL
SFFLECLKALRANAPIVYESLQKFSEKLNAFNRVRYLKSDLDLLHEQASRLGIVLATAKP
CLNGRFELLYYHLERSVSISYHRYGNLGSRVLRRPTCHKSCYAEK
NT seq 3558 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaaatcattgacgattcattagaattagccaaaaaactgcaagatagtatcagt
aaccatttgagcgagcaagaaaaagcgttccactctaaaatgcaaaagcttttaaataac
cctgaaaacaaagtcatgctcatagagcttatggatcggagttttagatgcctggacaat
aaagcccgctttgaaatgattgagcatgttttagacaaatacaaaagccgtgagattttt
tctccatttgaaaaattgcttttaatggggtttttgagctttgggaaaatgctccctgat
atgagcgtgcctttctttgtcaataaaatcagaagcgacacgaaagcgatggtcttggat
caagaagagagccaattaaaagagcggattttaaaaagaaaaaatgaaaaaatcattttg
aatgtgaattttattggcgaagaggttttaggcgaagaagaagctaatgcgcgttttgaa
aaatactctcaagccctaaaatccaactacattcaatacatttccattaaaatcacgacg
attttttctcaaatcaatatccttgattttgaatattctaaaaaagagattgtcaaacgt
ctagacgctctttatgccttggctttagaagaagaaaaaaagcaaggcatgcctaaattt
attaatttggatatggaggaatttagggatttagagctcacggtggagtcttttatggaa
tccatcgctaaatttgatttgaacgctggcattgtgttgcaagcctatatcccggattct
tatgaatatttgaaaaaactgcacgctttttctaaagaaagggttttaaaagggttaaag
cccattaaaatccgctttgttaagggagcgaacatggagagcgaagagactatcgcttcc
gtgaaagactgggcgttacccacattttctaataagcaagacaccgattctaattacaat
aaaatgctggattttgttttagagggcgataattataaatacattcatattggcgcagcg
agccataatatttttgaaatcgcttatgtttatacgcgcatccatgcccttaatgacccg
gttgtgttagagcattttagctttgaaatgctagagggcatgagtttgcaagcgagccag
gaactaaaagagatgcacaaactcattctttatgcaccggtgtgcgatgaagcgcatttt
aacaacgcgatcgcttacttggtgaggaggttagatgaaaacacctcaagcgataatttc
atgaaggctttctttaacctcaaagtaggcacgagcgaatgggaagatcaagagcaacgc
tttttaaacagccttaaaggaatcgctactttagacaatgccacccacaggactcaagat
agaaacgccaaacaaagcgggcataccacctacccaaaccactcctttaaaaacgaaagc
gataccgattttattttaaaggccaaccgagaatgggctaaaaaagtgcgcgaaaaaatg
cataatgcccctattttagaactttacccagaaatggatgggagatttgaagatcctaat
ttaacccctttagaagtctttgataaaatccatcataaaaaaatcgctagcgtgcattta
gcggataaggaagcgattttaaaagccctagaagtggctaaaagcgataagagccgtttc
agccaaaaaagctttacagaaatccatgccttaatgagtcaaaccgcccagctttttaga
gaaaggcgaggcgatttgatagggatttcggctttagaagtgggtaagactttcgctgaa
acggacgctgaagtgagcgaagccattgactttttagagttttacccttacagcttaagg
gtgttacaagagcagaataaaaaaacgaaattcacccccaaaggcgtgggtgtggtcatt
gccccatggaatttccctgtgggcatttctgtaggcactatcgctgcccccctagccgct
ggcaatcgggtgatttacaagccctcaagtttgtctagcgtaacgggttataagctttgt
gagtgcttttgggatgcgggcgtgcctagagatgcgctcatttacttgccctctaaaggg
agcgacattagcgagcatcttttaaaagatgaaagcatcaagtttgccattttaacaggg
ggcgaagacaccgcttataaaatgctagaagctaaccccactttagccttgagcgctgaa
acaggcggtaaaaacgccactattgtgagcaaaatggcagacagagatcaagcgattaag
aatgttatccattcagcttttagcaattcggggcaaaaatgctccgccacttcgctttta
gtgttggaaaaagaagtctatgaagatgagaactttaaaaagactctaatagatgcgact
ctaagccttagcgtgggcgatccttttgatttcaaaaacaaaatcggcactctagcggac
aagcctaatgaaaaggtcattaaagccatagacgaattgaaaagctatgaaaattacgaa
atcccggtaagctttgtcaatgataacccctatttgatgaagccaagcatcaaatacggc
actaaaaaaggcgatttcacgcaccaaactgagctttttacgcccattttatccgtgatg
aaagcgcaagatttagacgaagcgatagacatagtcaattctaccggttacgggctgacg
agtgcgttagagtctttggacgaaagggagtgggaatattatctaaaacgcattgaagcc
ggtaatatctatatcaacaagcccaccacaggagcgattgtcttacgccagccttttggg
ggggttaaaaaatccgctgtggggtttgggagaaaggtgggcatttttaactatatcacg
caatttgtgaatatccaccaagaagaagaagatgaaaacgccctaaaaaaccccttgagc
gaagctttagagggcttgactcaaaaaggctatgatgagcatacgcatgagttgaggcgc
gcgatttttatggcaaagagttacgcttatcattacaagcatgaattcagccaagctaaa
gactatgtcaaaatcagaggcgaagacaaccttttttcctacactaaagttaaaagcgtg
ggctatcgcatcaccgaaaaggacaccttaagcgatatgttaggcgttgctttagcatgt
ttaatttctcaaatccctttaacgctcagcatagaaaacgaacgagcgaacaaagattta
tcatttttcttagaatgcttaaaagcgctccgagcaaacgcccccattgtttatgaaagc
ttgcaaaaatttagcgagaaattgaacgctttcaatcgtgtccgttatttaaaaagcgat
ttggatttattgcatgaacaagcgagcagattagggattgttttagccacggctaaaccc
tgcttgaacgggcgttttgaattgctgtattaccacttagagcgatcggttagcatctct
tatcatcgttacgggaatttaggctcaagggttttaaggcgaccaacttgccacaaatca
tgttatgctgaaaaataa

DBGET integrated database retrieval system