KEGG   Helicobacter pylori Cuz20: HPCU_02050Help
Entry
HPCU_02050        CDS       T01894                                 

Definition
(GenBank) hypothetical protein
  KO
K06180  23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23]
Organism
hpu  Helicobacter pylori Cuz20
Brite
KEGG Orthology (KO) [BR:hpu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:hpu03009]
    HPCU_02050
Enzymes [BR:hpu01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.23  23S rRNA pseudouridine1911/1915/1917 synthase
     HPCU_02050
Ribosome biogenesis [BR:hpu03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    HPCU_02050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2
Motif
Other DBs
NCBI-ProteinID: ADO03583
Position
complement(402580..403461)
Genome map
AA seq 293 aa AA seqDB search
MPFVEEEFEILKPTKALFFVHDILKCSLKEAQRHLDKQRLKQNQQAVRKSQMIQGVVSLI
HFKPNEKTQALVFETKDFGVFDKPPQVYTHPKGYFYHESLLDCIQSHFGKNAHPAHRLDY
ETSGLVLAGKTLQSAKDLKTLFMQKKVKKTYLALAHGLVDKNIVIDKPILTPQNIQKDLR
IRSKISPLGKPSTTLVEPLSYNAFFDISLLKITPLTGRTHQIRLHLSSVGHRIVGEGLYG
VIDENAREYLQLKRENNAPLLMLHASSLAFEFKGAIHEITSPMPKRFMPFLKD
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
gtgccttttgttgaagaagaatttgaaattttaaaacccaccaaagccttgttttttgtg
cacgatattttaaaatgctctttaaaagaagcccagcgccaccttgacaaacaacgccta
aaacaaaaccaacaagccgtgcgtaaatctcaaatgattcaaggggtcgttagcttgatt
catttcaagcctaatgaaaaaactcaagcgcttgtttttgaaacgaaagattttggcgtg
tttgacaaaccccctcaagtctatacccaccctaaaggctatttttaccatgaaagctta
ctggattgtatccagtcgcattttggcaaaaacgcccacccagcccacagactggactat
gaaacgagcgggctagttttagcgggcaagactttacaaagcgctaaggatttaaaaacg
cttttcatgcaaaaaaaagtgaaaaaaacttacttggcgctagcgcatgggttggttgat
aaaaatatcgtcatagacaaacccattctaaccccacaaaacattcaaaaagatttgcgt
attcgatctaaaatttctcctttaggcaagccttcaaccacgcttgttgagcctttaagc
tataatgctttttttgatataagcttactcaaaataaccccactcaccgggcgcacgcac
cagatccgcttgcatttgagtagcgtgggtcataggatcgtgggcgaggggctttatggg
gtcatagatgaaaacgctagagaatacctccaattgaagcgtgaaaataacgccccatta
ctcatgctccatgcctctagtttggcatttgaatttaagggagcgatccatgagatcacc
tcccccatgccaaaacgcttcatgccgtttctaaaggattga

DBGET integrated database retrieval system