KEGG   Helicobacter pylori Cuz20: HPCU_03715Help
Entry
HPCU_03715        CDS       T01894                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
hpu  Helicobacter pylori Cuz20
Pathway
hpu00071  Fatty acid degradation
hpu00072  Synthesis and degradation of ketone bodies
hpu00280  Valine, leucine and isoleucine degradation
hpu00310  Lysine degradation
hpu00362  Benzoate degradation
hpu00380  Tryptophan metabolism
hpu00620  Pyruvate metabolism
hpu00630  Glyoxylate and dicarboxylate metabolism
hpu00640  Propanoate metabolism
hpu00650  Butanoate metabolism
hpu00900  Terpenoid backbone biosynthesis
hpu01100  Metabolic pathways
hpu01110  Biosynthesis of secondary metabolites
hpu01120  Microbial metabolism in diverse environments
hpu01130  Biosynthesis of antibiotics
hpu01200  Carbon metabolism
hpu01212  Fatty acid metabolism
hpu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:hpu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    HPCU_03715
   00630 Glyoxylate and dicarboxylate metabolism
    HPCU_03715
   00640 Propanoate metabolism
    HPCU_03715
   00650 Butanoate metabolism
    HPCU_03715
  09103 Lipid metabolism
   00071 Fatty acid degradation
    HPCU_03715
   00072 Synthesis and degradation of ketone bodies
    HPCU_03715
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    HPCU_03715
   00310 Lysine degradation
    HPCU_03715
   00380 Tryptophan metabolism
    HPCU_03715
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    HPCU_03715
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    HPCU_03715
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    HPCU_03715
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hpu04147]
    HPCU_03715
Enzymes [BR:hpu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     HPCU_03715
Exosome [BR:hpu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   HPCU_03715
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ADO03905
Position
753870..755045
Genome map
AA seq 391 aa AA seqDB search
MNEVVVVAAKRSAVGSFLGSLKSVGAREMGAVVLKDALKASGLKPSDVDSVILGNVLSAG
LGQNIARQIQLDAGIPNDRNAFSVNMVCGSSMKAIQLAHDSIMLGRDEVVVCGGVENMSA
APYLSFDMRDGKRMGNANMIDSMIHDGLWDAFNDYHMGITADNVAQAYHISREEQDTFAL
QSQLKARAAINAGKFQEEITPIEIANKKGVVVFKEDEYPRETTLESLAKLKPAFKKDGSV
TAGNSSGINDGASIIILCSAQKAQKLGLKTMAAIKGFGLGACSPDIMGICPSIAIKNNLK
NVKMNLNDINLFELNEAFAAQSIAVLKELELNPNIVNVNGGAIAIGHPIGASGARILVTL
LHEMKRSAQSVGCASLCVGGGQGLSVVVEQK
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaagtggttgtagtggcggcaaaacgaagtgcagtggggagttttttaggctct
ctaaagagcgtgggtgctagagaaatgggcgctgtcgtgcttaaagacgctttgaaggcg
agcggtcttaagcctagcgatgtggattctgtcattttaggcaatgttttatccgccggt
ttgggtcaaaatatcgccagacagatccaactggacgcgggcattccgaatgacaggaac
gcttttagcgtcaatatggtttgtggatcgtctatgaaagccattcaattagcgcatgac
agcatcatgcttgggcgcgatgaggtggtggtgtgcggtggcgtggaaaacatgagcgca
gcgccttatttgtcgtttgacatgcgagacgggaaaagaatggggaatgcgaacatgata
gactccatgatccatgatggattgtgggatgcgttcaatgattaccacatggggatcacc
gctgataatgtcgctcaagcataccacatcagccgagaagagcaagatactttcgcgctc
caatcgcaactcaaagcaagagctgccattaatgcagggaaattccaagaagaaatcacg
cccattgaaatagcgaataaaaaaggcgtggttgtttttaaagaagacgaataccctaga
gaaacgacgctagaatcccttgcaaagctcaaacccgctttcaaaaaagacggatcggta
acggcaggaaattcatcagggatcaacgatggcgcgagcattatcattttatgcagcgct
caaaaagcgcaaaaattggggttaaaaacaatggcggctatcaaggggtttggtttgggt
gcttgcagtccggatataatggggatatgccctagcatcgctattaaaaacaaccttaaa
aatgtcaaaatgaatctcaacgacatcaatctttttgaactcaatgaagccttcgccgcg
caaagcatagccgtgttaaaagagcttgaattaaaccctaatatcgtgaatgtgaatgga
ggtgcaatagccattggccaccctattggcgcaagcggtgctaggatcttggtaacttta
ttgcatgaaatgaaaagaagcgctcaaagcgtgggctgcgcgtcattgtgtgtgggcggc
ggacaagggctatcagtggtagtggaacaaaaataa

DBGET integrated database retrieval system