KEGG   Helicobacter pylori Cuz20: HPCU_05625Help
Entry
HPCU_05625        CDS       T01894                                 

Gene name
porA
Definition
(GenBank) pyruvate flavodoxin oxidoreductase subunit alpha
  KO
K00169  pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
hpu  Helicobacter pylori Cuz20
Pathway
hpu00010  Glycolysis / Gluconeogenesis
hpu00020  Citrate cycle (TCA cycle)
hpu00620  Pyruvate metabolism
hpu00640  Propanoate metabolism
hpu00650  Butanoate metabolism
hpu00680  Methane metabolism
hpu01100  Metabolic pathways
hpu01120  Microbial metabolism in diverse environments
hpu01130  Biosynthesis of antibiotics
hpu01200  Carbon metabolism
Module
hpu_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:hpu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HPCU_05625 (porA)
   00020 Citrate cycle (TCA cycle)
    HPCU_05625 (porA)
   00620 Pyruvate metabolism
    HPCU_05625 (porA)
   00640 Propanoate metabolism
    HPCU_05625 (porA)
   00650 Butanoate metabolism
    HPCU_05625 (porA)
  Energy metabolism
   00680 Methane metabolism
    HPCU_05625 (porA)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    HPCU_05625 (porA)
Enzymes [BR:hpu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     HPCU_05625 (porA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR_N PFOR_II Transketolase_C TPP_enzyme_N
Motif
Other DBs
NCBI-ProteinID: ADO04273
Position
1152658..1153881
Genome map
AA seq 407 aa AA seqDB search
MARSIELQEIEVWDGNTASSNALRQAQIDVIAAYPITPSTPIVQNYGSFKDNGYIDGEFV
LVESEHAAMSACVGAAAAGGRVSTATSSQGLALMVEVLYQASGMRLPIVLNLVNRALAAP
LNIHGDHSDMYLSRDSGWISLCTCNPQEAYDFTLMAFRIAEHQKVRVPTIVNQDGFLCSH
TVQNVRPLSDAVAYQFVGEYQTKHSLLDFDKPVSYGAQAEEEWHYEHKAQLHHAIMSASS
VIEEVFNDFAKLTGRQYHLTRTFQLEDAEIAIFALGTTYESAIVAAKEMRKKGIKAGVAT
IHSLRPFPYERLGQDLKNLKALAILDKSSPAGAMGAMFNEVTSAVYQTQGTKHPVVSNYI
YGLGERDMTIVHLCEIFEEINEDALKGTLTHPTQQFVGLRGPKMSFF
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atggcaagaagtattgaattacaagagatagaagtgtgggatggcaataccgctagctct
aacgctttaagacaggctcaaattgatgtcatcgcagcctatcctatcaccccatcaacg
cccattgtgcaaaattacggctcgtttaaggataatggctatattgatggcgaatttgtt
ttagtggaatctgagcatgccgccatgagcgcatgcgtgggagctgcagcagctggtgga
agggttagcactgcgactagctctcaaggtttggcgttaatggtagaggttttataccag
gcttctggcatgcgtttgcctatcgttttgaatttagtcaatcgcgctttagcagcccct
ttgaatatccatggcgatcattctgatatgtatttaagcagggattctggctggataagt
ttatgcacatgcaacccccaagaagcttatgatttcactttaatggcgtttagaatcgca
gagcatcaaaaggtgcgcgtgcccactattgtcaatcaagatggctttttatgctcgcac
accgtgcaaaatgtccgccccttgagcgatgcagtggcttaccaattcgtaggcgaatac
caaaccaagcattcccttttggattttgataagccggtaagctatggcgcacaagctgaa
gaagaatggcattatgaacataaagcccaactccaccatgcgatcatgagcgcgtcttct
gtgattgaagaagtgttcaatgatttcgctaaactcaccggcagacaataccatttgact
agaactttccagctagaagacgctgaaatcgctatctttgcgttaggcactacttatgaa
tcagcgatcgtagcggctaaagaaatgcgtaaaaaaggcattaaggccggcgtggcgacc
atccattccttacgccccttcccttatgaaagattagggcaggatttgaaaaaccttaaa
gctttagcgattttagacaagagctctccagcgggtgctatgggagcgatgtttaatgaa
gtaacgagcgcggtgtatcaaacgcaagggactaaacaccccgtggtgtctaactatatc
tatggtttaggcgaaagggatatgacaatcgtgcatttatgcgaaatttttgaagaaatc
aacgaagacgctcttaaaggcacgctcacgcaccctacccaacaattcgtaggtttgcgt
ggccctaaaatgagctttttttaa

DBGET integrated database retrieval system