KEGG   Helicobacter pylori Cuz20: HPCU_07515Help
Entry
HPCU_07515        CDS       T01894                                 

Definition
(GenBank) phosphate permease
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
hpu  Helicobacter pylori Cuz20
Brite
KEGG Orthology (KO) [BR:hpu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    HPCU_07515
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 RnlB_antitoxin NnrS DUF1240
Motif
Other DBs
NCBI-ProteinID: ADO04643
Position
complement(1510769..1512370)
Genome map
AA seq 533 aa AA seqDB search
MEIKNIKEFEKASKKLQKDTLKIALALLFLIGTALLALIFGQANSKGLLLTFAAVIGGYM
AMNIGANDVSNNVGPAVGSKAISMGGAILIAGICEMLGAIIAGGEVVSTIKGRIVSPESI
NDAHVFINVMLASLLSGALWLHVATLIGAPVSTSHSVVGGIMGAGMAAAGMSAVNWHFLS
GIVASWVVSPLMGALIAMFFLMLIKKTIAYKEDKKSAALKVVPYLVALMSLSFSWYLIIK
VLKRLYALNFEIQLACGCILALLIFILFKRFVLKKAPQLENSHESINELFNIPLIFAAAL
LSFAHGANDVANAIGPLAAISQTLEDANSPIGNTLSSVPLWIMVVGAAGIALGLSLYGPK
LIKTVGSEITELDKMQAFCIALSAVITVLLASQLGLPVSSTHIVVGAVFGVGFLRERLRE
QSRRRFARIRDNIVAAHFGEDLEEIEGFLERFDKANLKEKSLMLESLKKSKNTAIALELK
KKEKKSLKKVYKEEVIKRSILKKIVTAWLVTVPVSALLGAILFVALGFIEKYF
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atggaaattaaaaacatcaaggagtttgaaaaagcttctaaaaaactccaaaaagacact
ttaaagatcgctctcgctcttttgtttctcattggcactgctttgctcgctcttattttt
gggcaggctaattctaagggattgttgctcacttttgcggctgtgattggggggtatatg
gcgatgaatattggcgcgaatgatgtgtccaataatgtcggccctgccgtaggatctaaa
gccattagcatgggtggggcgattttgattgctgggatttgtgaaatgcttggagcgatc
attgctgggggggaagtggtttctacgattaagggccgtatcgtttcgcctgaatccatt
aatgatgcgcatgttttcatcaatgtcatgttggctagccttttgagtggggcgttgtgg
ttgcatgtagccactttaattggcgctcctgtttccacttcacactctgtggtgggggga
attatgggggctggaatggcagcagctggaatgtctgctgtcaattggcattttttatca
ggtattgtggccagttgggtggtttcgcctttaatgggggctttgatagccatgtttttt
ttaatgctcattaaaaagactatcgcttataaagaagataaaaagagcgcggctttaaag
gtcgtgccttacttggtggcgttgatgagtttatcgtttagctggtatttgattattaag
gttttaaaacgcctctatgcactgaattttgaaatccaattggcttgcggctgtatcctt
gcgcttttaatctttatcctttttaaaaggtttgtgttaaagaaagccccgcaattagaa
aatagccatgaaagcattaatgaacttttcaatatccctttgatttttgccgctgcgctt
ttaagctttgcgcatggggctaatgatgtggctaacgctataggccccttagcggccatc
agtcaaactttagaagatgcaaatagccctatagggaataccttaagctctgtgccgttg
tggattatggtagtgggggcagctgggattgctttaggcttgagtttgtatgggccaaag
ctcattaaaacggtggggtctgaaatcacagaattggacaaaatgcaagctttttgcatc
gcgctttctgcggttatcaccgtgcttttagcttctcaattaggcttgcctgtgagctct
acgcatattgtggtgggcgcggtgtttggggtgggctttttaagggagcgcttaagagag
caatcaagaaggcgttttgctaggatcagagacaacattgtagcggcgcactttggggaa
gatttagaagaaattgaaggttttttagagcgctttgataaagccaacttgaaagaaaaa
tcgctcatgctagagagcttgaaaaaaagcaagaacaccgccatcgctttggaattgaaa
aagaaagaaaaaaagtcgcttaaaaaagtgtataaagaagaagtgatcaaacgctccatt
ttaaaaaagattgttaccgcttggcttgtaaccgtgccggtttctgcgcttttgggggcg
attctttttgtggctcttggttttatagaaaagtatttctag

DBGET integrated database retrieval system