KEGG   Helicobacter pylori v225d: HPV225_0094Help
Entry
HPV225_0094       CDS       T01899                                 

Definition
(GenBank) Hypothetical protein
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
hpv  Helicobacter pylori v225d
Pathway
hpv00020  Citrate cycle (TCA cycle)
hpv00620  Pyruvate metabolism
hpv01100  Metabolic pathways
hpv01110  Biosynthesis of secondary metabolites
hpv01120  Microbial metabolism in diverse environments
hpv01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hpv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    HPV225_0094
   00620 Pyruvate metabolism
    HPV225_0094
Enzymes [BR:hpv01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     HPV225_0094
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo DAO Pyr_redox_2 NAD_binding_8 Pyr_redox_3 Lycopene_cycl Pyr_redox FAD_binding_2 Thi4 PEX-1N K_oxygenase Amino_oxidase
Motif
Other DBs
NCBI-ProteinID: ADI34195
UniProt: D6XN51
Position
complement(80497..81849)
Genome map
AA seq 450 aa AA seqDB search
MSMEFDAVIIGGGVSGCATFYTLSEYSSLKRVAIVEKCSKLAQISSSAKANSQTIHDGSI
ETNYTPEKAKKVRLSAYKTRQYALNKGLQNEVIFETQKMAIGVGDEEYEFMKKRYESFKE
IFVGLEEFDKQKIKELEPNVILGANGIDRHENIIGHGYQKDWSTMNFAKLSENFVEEALK
LKPNNQVFLNFKVKKIEKRNDTYAVISEDAEEVYAKFVLVNAGSYALPLAQSMGYGLDLG
CLPVAGSFYFVPDLLRGKVYTVQNPKLPFAAVHGDPDAVIKGKTRIGPTALTMPKLERNK
CWLKGISLELLKMDLNKDVFKIAFDLMSDKEIRNYVFKNMVFELPIIGKRKFLKDAQKII
PSLSLEDLEYAHGFGEVRPQVLDKTKRKLELGEKKICTHKGITFNMTPSPGATSCLQNAL
VDSQEIAAYLGESFELERFYKDLSPEELEN
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgagtatggaatttgatgctgttattattggaggtggggtttcagggtgcgcgaccttt
tatactttgagcgaatacagctctctaaagcgcgtggctatcgtggaaaaatgctctaaa
ttagctcaaatcagctccagcgctaaagctaattcacaaaccattcatgatggctctatt
gaaacgaattacactcccgaaaaagctaaaaaagtgcgtttgagcgcttataaaaccagg
caatacgcgctcaataaaggcttgcaaaatgaagtgatttttgaaacccagaaaatggct
ataggcgtgggcgatgaagaatacgagttcatgaaaaagcgctacgaatcctttaaagaa
atctttgtggggttagaagaatttgacaaacaaaagattaaagaattagagcctaatgtg
attttaggggctaatggcatagacaggcatgaaaacattatcgggcatgggtatcaaaaa
gattggagcaccatgaattttgcgaagttgagtgaaaacttcgttgaagaagccctaaaa
ttaaagcctaacaaccaggtgtttttgaatttcaaagtgaaaaagattgaaaaacgcaac
gacacttacgccgtaatttcagaagacgctgaagaagtgtatgctaaattcgtgctggtc
aatgccggctcttacgctttgcctttggctcagagcatgggttatggcttggatttaggg
tgcttgcctgtggcgggcagcttttattttgtgccggatttgttaaggggtaaggtttat
accgttcaaaaccctaaactcccttttgcagccgtgcatggcgaccctgatgccgtcatt
aaaggaaaaacacgaatcggacctaccgctttaacgatgcccaaattagaacgaaacaaa
tgctggcttaagggtattagcttggaattgttgaaaatggatttgaataaagatgtgttt
aagattgcgtttgatttgatgagcgataaagaaatccgtaattatgtgtttaaaaacatg
gtttttgagttgcccattataggtaaaaggaaatttttaaaagacgctcaaaaaatcatc
ccctctcttagcctagaagatttagaatacgctcatggttttggcgaagtgcgcccgcaa
gttttagataaaaccaagcgaaagctggaattaggcgaaaaaaagatttgcacccataaa
ggcatcacttttaacatgaccccctctccaggcgcgacgagttgtttgcaaaacgccctt
gtggattcccaagaaatcgctgcgtatttgggcgagagctttgaattagaacgcttttat
aaagatttatccccagaagaattggaaaattaa

DBGET integrated database retrieval system