KEGG   Helicobacter pylori v225d: HPV225_0697Help
Entry
HPV225_0697       CDS       T01899                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
hpv  Helicobacter pylori v225d
Pathway
hpv00071  Fatty acid degradation
hpv00072  Synthesis and degradation of ketone bodies
hpv00280  Valine, leucine and isoleucine degradation
hpv00310  Lysine degradation
hpv00362  Benzoate degradation
hpv00380  Tryptophan metabolism
hpv00620  Pyruvate metabolism
hpv00630  Glyoxylate and dicarboxylate metabolism
hpv00640  Propanoate metabolism
hpv00650  Butanoate metabolism
hpv00900  Terpenoid backbone biosynthesis
hpv01100  Metabolic pathways
hpv01110  Biosynthesis of secondary metabolites
hpv01120  Microbial metabolism in diverse environments
hpv01130  Biosynthesis of antibiotics
hpv01200  Carbon metabolism
hpv01212  Fatty acid metabolism
hpv02020  Two-component system
Brite
KEGG Orthology (KO) [BR:hpv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    HPV225_0697
   00630 Glyoxylate and dicarboxylate metabolism
    HPV225_0697
   00640 Propanoate metabolism
    HPV225_0697
   00650 Butanoate metabolism
    HPV225_0697
  09103 Lipid metabolism
   00071 Fatty acid degradation
    HPV225_0697
   00072 Synthesis and degradation of ketone bodies
    HPV225_0697
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    HPV225_0697
   00310 Lysine degradation
    HPV225_0697
   00380 Tryptophan metabolism
    HPV225_0697
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    HPV225_0697
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    HPV225_0697
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    HPV225_0697
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hpv04147]
    HPV225_0697
Enzymes [BR:hpv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     HPV225_0697
Exosome [BR:hpv04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   HPV225_0697
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ADI34774
UniProt: D6XPT0
Position
691653..692828
Genome map
AA seq 391 aa AA seqDB search
MNEVVVVAAKRSAIGSFLGSLKSVDAREMGAIVLKDALNASGLKPSDVDSVILGNVLSAG
LGQNIARQIQLDAGIPNDRNAFSVNMVCGSSMKAIQLAHDSIMLGRDEVVVCGGVENMSA
APYLSFDMRDGKRMGNANMIDSMIHDGLWDAFNDYHMGITADNVAQAYHISREEQDAFAL
QSQLKARVAINAGKFQEEITPIEIANKKGVVVFKEDEYPRETTLESLAKLKPAFKKDGSV
TAGNSSGINDGASVIILCSAQKAQKLGLKTMATIKGFGLGGCSPDIMGICPSIAIKNNLK
NVKMNLNDINLFELNEAFAAQSIAVLKELELNPNIVNVNGGAIAIGHPIGASGARILVTL
LHEMKRSAQSVGCASLCVGGGQGLSVIVEQK
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaagtggttgtagtggcggcaaaacgaagcgctatagggagttttttaggctct
ctaaagagcgtggacgctagagaaatgggcgctatcgtgcttaaagacgctttgaatgcg
agcggtcttaagcctagcgatgtggattctgtcattttaggcaatgttttatccgctggt
ttgggtcaaaatatcgccaggcagatccaactggacgctggcataccgaatgacaggaac
gcttttagcgtcaacatggtttgtggatcgtctatgaaagccattcaattagcgcatgac
agcatcatgcttgggcgcgatgaggtggtggtgtgcggtggcgtggaaaacatgagtgca
gccccctatttgtcgtttgacatgcgagacgggaaaagaatggggaatgcgaacatgata
gactccatgatccatgatggattgtgggatgcgttcaatgattaccacatggggatcacc
gctgataatgtcgctcaagcataccacatcagccgggaagagcaagatgctttcgcgctc
caatcgcaactcaaagcaagagtcgccattaatgcagggaaattccaagaagaaatcacg
cccattgaaatagcgaataaaaaaggcgtggttgtttttaaagaggacgaataccctaga
gaaacgacgctagaatcccttgcaaagctcaaacccgctttcaaaaaagacggatcggta
acggcaggaaattcatcagggatcaatgatggcgcgagcgttatcattttatgcagcgct
caaaaagcgcaaaaattaggattaaaaacaatggcaactatcaaggggtttggtttgggt
ggttgcagtccggatataatggggatatgccctagcatcgctattaaaaacaaccttaaa
aatgtcaaaatgaatctcaacgacatcaatctttttgaactcaatgaagctttcgccgcg
caaagcatagccgtgttaaaagagcttgaattaaaccctaatatcgtgaatgtgaatgga
ggcgcgatagccattggccaccctattggcgcgagcggtgctaggatcttggtaacttta
ttgcatgaaatgaaaagaagcgctcaaagcgttggctgtgcgtcattgtgtgtgggcggc
ggacaagggctatcagtaatagtggaacaaaaataa

DBGET integrated database retrieval system