KEGG   Helicobacter pylori v225d: HPV225_1121Help
Entry
HPV225_1121       CDS       T01899                                 

Gene name
glk
Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
hpv  Helicobacter pylori v225d
Pathway
hpv00010  Glycolysis / Gluconeogenesis
hpv00052  Galactose metabolism
hpv00500  Starch and sucrose metabolism
hpv00520  Amino sugar and nucleotide sugar metabolism
hpv00521  Streptomycin biosynthesis
hpv01100  Metabolic pathways
hpv01110  Biosynthesis of secondary metabolites
hpv01120  Microbial metabolism in diverse environments
hpv01130  Biosynthesis of antibiotics
hpv01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hpv00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HPV225_1121 (glk)
   00052 Galactose metabolism
    HPV225_1121 (glk)
   00500 Starch and sucrose metabolism
    HPV225_1121 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    HPV225_1121 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    HPV225_1121 (glk)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    HPV225_1121 (glk)
Enzymes [BR:hpv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     HPV225_1121 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase
Motif
Other DBs
NCBI-ProteinID: ADI35165
UniProt: D6XQX1
Position
1105656..1106666
Genome map
AA seq 336 aa AA seqDB search
MPKTETYPKLLADIGGTNARFGLEVAPRQIECIEVLLCKDFESLSDAVRFYLSKCKESLK
LRPIYGSFAVATPIMGDFVQMTNNHWTFSIETTRQCLDLKKLLVINDFVAQAYAISAMQE
NDLAQIGGIKCEINAPKAILGPGTGLGVSTLIQNSDGSLKVLPGEGGHVSFAPFDDLEIL
VWQYARSKFNHVSAERFLSGSGLVLIYEALSKRKGLEKMAKLSKAELTPQIISERALNGD
YPICRLTLDTFCSMLGTLAADVALTLGARGGVYLCGGIIPRFIDYFKTSPFRARFETKGR
MGAFLASIPVHVVLKKTPGLDGAGIALENYLLHDKI
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaaactgaaacttacccaaaactattagccgatattggcggcacgaacgcgcgc
tttggtttagaggtcgccccacgacagattgaatgcattgaagttttgctatgcaaagat
tttgaaagcttgagcgatgcggtgcgattctatctttctaaatgcaaagaaagccttaaa
ctgcgccctatttatggctcttttgcggtggctacgcccattatgggggattttgtccaa
atgactaacaaccactggactttttctattgaaacgacacggcaatgtttggatttaaaa
aaattgcttgtcatcaacgattttgtcgcgcaagcctatgccattagcgcgatgcaagaa
aacgatctggctcaaataggcgggattaagtgcgaaatcaacgctcctaaagcgatttta
gggccaggaactgggcttggggtaagcactcttatccaaaacagcgatggctctttaaaa
gtcttgcccggtgaaggggggcatgtgagcttcgccccttttgatgatttagaaatttta
gtgtggcaatacgcccgctctaaattcaatcatgtgagcgcggaaaggtttttgagcggg
agcggtttggtgttgatttatgaagccctgtctaaacgcaaaggcttagaaaaaatggcg
aagttaagcaaggctgaattaaccccacaaatcattagcgaacgcgctttgaatggggat
taccctatatgccgattgactttggacactttttgctccatgctaggcacgctcgctgct
gatgtggctctcactttgggggctagggggggcgtgtatttgtgtggggggattatccca
cgattcattgattattttaaaacttcgccctttagagcgcgttttgaaacgaaagggcgc
atgggagcgtttctcgcttctatccctgtgcatgtcgtgctgaaaaaaactccgggactt
gatggggcaggcattgcgttagagaattatttactgcatgataagatatag

DBGET integrated database retrieval system