KEGG   Helicobacter pylori 2018: hp2018_0685Help
Entry
hp2018_0685       CDS       T01914                                 

Definition
(GenBank) 3-ketoacyl-CoA thiolase/Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
hpw  Helicobacter pylori 2018
Pathway
hpw00071  Fatty acid degradation
hpw00072  Synthesis and degradation of ketone bodies
hpw00280  Valine, leucine and isoleucine degradation
hpw00310  Lysine degradation
hpw00362  Benzoate degradation
hpw00380  Tryptophan metabolism
hpw00620  Pyruvate metabolism
hpw00630  Glyoxylate and dicarboxylate metabolism
hpw00640  Propanoate metabolism
hpw00650  Butanoate metabolism
hpw00900  Terpenoid backbone biosynthesis
hpw01100  Metabolic pathways
hpw01110  Biosynthesis of secondary metabolites
hpw01120  Microbial metabolism in diverse environments
hpw01130  Biosynthesis of antibiotics
hpw01200  Carbon metabolism
hpw01212  Fatty acid metabolism
hpw02020  Two-component system
Brite
KEGG Orthology (KO) [BR:hpw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    hp2018_0685
   00630 Glyoxylate and dicarboxylate metabolism
    hp2018_0685
   00640 Propanoate metabolism
    hp2018_0685
   00650 Butanoate metabolism
    hp2018_0685
  09103 Lipid metabolism
   00071 Fatty acid degradation
    hp2018_0685
   00072 Synthesis and degradation of ketone bodies
    hp2018_0685
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    hp2018_0685
   00310 Lysine degradation
    hp2018_0685
   00380 Tryptophan metabolism
    hp2018_0685
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    hp2018_0685
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    hp2018_0685
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    hp2018_0685
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hpw04147]
    hp2018_0685
Enzymes [BR:hpw01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     hp2018_0685
Exosome [BR:hpw04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   hp2018_0685
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ADZ51381
Position
complement(700837..702012)
Genome map
AA seq 391 aa AA seqDB search
MNEVVVVAAKRSAVGSFLGSLKNVGARQMGVSVLKDALNASSLKPSDVDSVVLGNVLGAG
LGQNIARQIQLDAGIPNDRNAFSVNMVCGSSMKAIQLAHDSIMLGRDEVVVCGGVENMSA
APYLSFDMREGKRMGNANMIDSMIHDGLWDAFNDYHMGITADNVAQAYHISREDQDAFAL
QSQLKARAAINAGKFQEEITPIEIASKKGVVVFKEDEYPRDTTLESLAKLKPAFKKDGSV
TAGNSSGINDGASIIILCSAKKAQKLGLKTMATIKGFGLGGCSPDIMGICPSIAIKNNLK
NAKMNLNDINLFELNEAFAAQSIAVLKELELNPNIVNVNGGAIAIGHPIGASGARILVTL
LHEMKRSGHGVGCASLCVGGGQGLSVVVEQK
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaagtggttgtagtggcggcaaagcgtagcgctgtagggagttttttaggctct
ctaaagaatgtgggcgctaggcaaatgggcgttagcgtgcttaaagacgctttgaacgcg
agctctcttaagcctagcgatgtggattctgtcgttttaggcaatgtcttaggcgctggt
ttgggtcaaaatatcgccagacagatccaactagacgccggtatccctaatgacagaaac
gcttttagcgtcaatatggtttgcggatcatctatgaaagctattcagttagcgcatgac
agcatcatgcttgggcgcgatgaagtggtggtgtgcggtggcgtggaaaacatgagcgca
gcgccttatctgtcgtttgacatgcgagaggggaaaagaatggggaatgcgaacatgata
gattccatgatacatgacggattgtgggatgcgttcaatgattaccacatggggatcact
gctgataatgtcgctcaagcataccacataagccgagaagatcaagacgcattcgcgctc
cagtcgcaactcaaagcgagagccgccatcaatgcagggaaattccaagaagaaatcacg
cctattgaaatagcgagtaaaaaaggcgtggtggtttttaaagaagacgaataccctaga
gacacgacgctagaatcccttgcaaagctcaaacccgctttcaaaaaagacggctcggta
acggcaggaaattcatcagggatcaatgatggcgcgagcattatcattttatgcagcgct
aaaaaagcgcaaaaattggggttaaaaacaatggccactatcaaggggtttggtttgggt
ggttgtagtccggatattatgggcatatgcccaagcatcgctattaaaaacaatcttaaa
aatgccaaaatgaatctcaatgacatcaatctttttgaactcaatgaagcctttgccgct
caaagcatcgccgtgctaaaagagcttgaattaaaccctaatatcgtgaacgtgaatgga
ggcgcgatagcaattggccaccctattggcgcgagcggcgctagaatcttagtgacttta
ttgcatgaaatgaaaagaagcgggcatggcgtgggttgcgcgtcattgtgcgtgggtggc
ggtcaagggctatcagtggtagtggaacaaaaataa

DBGET integrated database retrieval system