KEGG   Helicobacter pylori 2018: hp2018_09942Help
Entry
hp2018_09942      CDS       T01914                                 

Gene name
metG2
Definition
(GenBank) Methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
hpw  Helicobacter pylori 2018
Pathway
hpw00450  Selenocompound metabolism
hpw00970  Aminoacyl-tRNA biosynthesis
hpw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hpw00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    hp2018_09942 (metG2)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    hp2018_09942 (metG2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:hpw01007]
    hp2018_09942 (metG2)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:hpw03016]
    hp2018_09942 (metG2)
Enzymes [BR:hpw01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     hp2018_09942 (metG2)
Amino acid related enzymes [BR:hpw01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   hp2018_09942 (metG2)
Transfer RNA biogenesis [BR:hpw03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    hp2018_09942 (metG2)
 Prokaryotic type
   Other AARSs
    hp2018_09942 (metG2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e
Motif
Other DBs
NCBI-ProteinID: ADZ51708
Position
complement(1013094..1014710)
Genome map
AA seq 538 aa AA seqDB search
MQKSLITTPIYYVNDIPHIGHAYTTLIADTLKKYYTLQGEEVFFLTGTDEHGQKIEQSAR
LRNQSPKAYADSISAIFKNQWDFFNLDYDGFIRTTDREHQKCVQNAFEIMFEKGDIYKGT
YSGHYCVSCESYCAISKTDNTNDKVLCPDCLRETTLLEEESYFFKLSAYEKPLLEFYAKN
PEAILPIYRKNEVTSFIEQGLLDLSITRTSFEWGIPLPKKMNDPKHVVYVWLDALLNYAS
ALGYLNGLDNKMAHFERARHIVGKDILRFHAIYWPAFLMSLNLPLFKQLCVHGWWTIEGV
KMSKSLGNVLDAQKLAMEYGIEELRYFLLREVPFGQDGDFSKKALVERINANLNNDLGNL
LNRLLGMAKKYFNYSLKSAKITAYYPKELEKAHQILDNANSFVPKMQLHKALEELFNIYD
FLNKLIAKEEPWVLHKNNESEKLEALLSLIANTLLQSSFLLYAFMPKSAMKLASAFRVEI
TPNNYERFFKAKKLQDMVLQDTEPLFCKMEKVEKAPLKENQKSRKRKSPTNTRKLYQY
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaatcactgatcacaacccccatttattatgtgaatgacatccctcatattggc
catgcttatacgactttgattgcggacactttaaagaagtattacacgcttcaaggcgaa
gaagtcttttttttaaccggcaccgatgagcatgggcaaaagatcgaacaaagcgcgagg
ttgagaaatcaaagccccaaagcttacgccgatagcattagcgcgatttttaaaaaccag
tgggattttttcaatttggattatgatggttttatccgcaccacagacagagagcatcaa
aaatgcgtgcaaaacgcctttgaaatcatgtttgaaaaaggggatatttataaaggcact
tatagcgggcattattgcgtgagctgtgagagttattgcgcgatttctaaaacggacaac
acgaacgataaagtcttatgccctgattgcttgagggagaccacgcttttagaagaagag
agctatttttttaaattgagcgcgtatgaaaagcctttattggagttttacgctaaaaac
cctgaagcgattttgcccatttatcgtaaaaacgaggtaacttcttttattgagcagggt
ttattggatctgtctatcacgcgtacgagctttgagtggggcattcctttgcctaaaaag
atgaacgatcctaaacatgtggtgtatgtttggctggacgctttattgaattatgcgagc
gcgttagggtatttgaacggtttagacaataaaatggcgcattttgaacgtgctaggcat
attgtgggtaaggatattttacgcttccatgctatttattggccagcctttttgatgagt
ttgaatttgcccttattcaaacagctttgcgtgcatgggtggtggacgatagagggcgtg
aaaatgagtaagagcttgggtaatgttttagacgctcaaaagctcgctatggagtatggg
attgaagaattacgctattttttattgcgtgaagtgccttttgggcaagatggggatttt
tctaaaaaagcgttagtagaaaggattaatgcgaatttgaacaacgatttggggaatttg
ctgaatcgcttgctaggcatggctaaaaagtatttcaattattctttaaaaagcgccaaa
atcactgcgtattatcctaaagagctagaaaaagcgcatcaaattttagataacgctaat
tctttcgtgcctaaaatgcagttgcataaggctttagaggaattgtttaatatttatgat
tttttaaataaactcatcgctaaagaagagccgtgggtcttgcataaaaacaacgaatca
gaaaaactagaagctttattgagtttgatcgcaaacacgctactacaatcaagcttcttg
ctctatgcgttcatgccaaagagcgctatgaaattagcgagcgcttttcgtgtagaaatc
acgcccaataattacgaacgcttttttaaggctaaaaaattacaagatatggttttacaa
gacaccgagcctttattttgtaaaatggaaaaagtggaaaaagccccactaaaagaaaat
caaaaaagcagaaaaagaaaaagccccaccaacacaagaaaattatatcagtattga

DBGET integrated database retrieval system